BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1304 (568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0252 - 1657268-1657692,1657727-1658445,1658761-1659089,165... 31 0.64 >02_01_0252 - 1657268-1657692,1657727-1658445,1658761-1659089, 1659223-1659375,1659430-1659561,1659748-1659852, 1660020-1660193,1660283-1660352,1660458-1660639, 1660738-1660847,1660948-1661052,1661153-1661231, 1662128-1662168,1662283-1662358,1662455-1662589 Length = 944 Score = 31.1 bits (67), Expect = 0.64 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 235 RGDGNLPGLFVDRLHEKVHTFDLRGRV--QEYSFCLLFLWHQVFVYQE 372 +GDG+ P L R+ K FDL R+ E + LL LW FV E Sbjct: 684 QGDGHFPVLTDVRMDNKAWLFDLLDRLSESERAALLLVLWRNWFVRNE 731 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,124,679 Number of Sequences: 37544 Number of extensions: 236262 Number of successful extensions: 509 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -