BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1303 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 27 2.2 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 27 2.2 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 27 3.0 SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 26 5.2 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 26 5.2 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 653 NRHNNKYSYTSTSDDNLLKNIELFDKLSLRF 745 + +NN + T+T DD+ L +EL + L L F Sbjct: 539 SNNNNNNNNTNTDDDDKLAYLELHEALKLAF 569 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 653 NRHNNKYSYTSTSDDNLLKNIELFDKLSLRF 745 + +NN + T+T DD+ L +EL + L L F Sbjct: 539 SNNNNNNNNTNTDDDDKLAYLELHEALKLAF 569 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 27.1 bits (57), Expect = 3.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 222 QNVVKRQSVTIVKLNVGGTLFYTTIGTLTKSDNMLRT 332 + ++ S I++ ++ YTTIG LTK DN L T Sbjct: 321 EKILSILSSNIIQSDLLRGFLYTTIGLLTKVDNHLIT 357 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 26.2 bits (55), Expect = 5.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -3 Query: 467 LFITVG*RYCAVTKIIQNSTEMLPTTINQNP 375 +++ + +YC V K +++ EM P + Q+P Sbjct: 471 IYLNLNEQYCLVMKDLKDGIEMKPKWLTQSP 501 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 384 IDRCGKHFGTILNYLRDGTVALPDSYKEIMELL 482 +DR G+ GT++N + D + DS EI+++L Sbjct: 534 LDRLGEDLGTVINQMNDFSKP-DDSISEIVKVL 565 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,018,041 Number of Sequences: 5004 Number of extensions: 59614 Number of successful extensions: 142 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -