BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1303 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 27 0.19 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 26 0.45 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 2.4 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 9.6 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 9.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.6 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 27.1 bits (57), Expect = 0.19 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 357 LTDSEGWILIDRCGKHFGTILNYLRDGTVALPD---SYKEIMELLAEAKY 497 LT + G L+ +F TIL +RD T LP+ + +I +LL +++Y Sbjct: 639 LTKARGHSLLVADRPNFVTILALVRDATARLPNGEGTRADICQLLKDSQY 688 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 25.8 bits (54), Expect = 0.45 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +2 Query: 590 SQKEEQLLIMSTSK--PVVKL--LINRHNNKYSYTSTSDDNLLKN 712 S++E L+++ SK +V + L+N+ NN YTS+ + NL N Sbjct: 498 SEEEAVSLLINFSKNNTIVDISKLVNKRNNAKIYTSSVNSNLTVN 542 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 198 F*NNVGRSQNVVKRQSVTIVKLNVGGTLFYT 290 F NN+ QNVV + V IV L G++ ++ Sbjct: 3 FTNNIAAFQNVVLVKKVKIVLLIFYGSIMFS 33 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 156 HPDSQLFSCSKCTYT 112 H S+ F C KC+Y+ Sbjct: 11 HFGSKPFKCEKCSYS 25 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/25 (32%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = -2 Query: 174 NTKRPVHPDSQLFSCSKCTYTT-FC 103 N+ H + + C+ CTY T +C Sbjct: 33 NSHLKSHSNVYQYRCANCTYATKYC 57 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.4 bits (43), Expect = 9.6 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 413 STEMLPTTINQNPPFRICE--NLHPPTKH 333 ST ++PTT N PF+ E N+ T H Sbjct: 82 STTIVPTTQEINKPFKRLELFNITTTTIH 110 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 244 DCLLTTFCDLPTLFQNEEITSTR 176 D +TT +P+L N ITS + Sbjct: 409 DITVTTDASVPSLVSNVRITSVK 431 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 446 RYCAVTKIIQNSTEMLPTTINQNPPFRICENLHPP 342 R +V + + N T ++ ++NP LHPP Sbjct: 494 RVLSVKRELGNDTVIVMMNFSKNPVTVNLTKLHPP 528 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,978 Number of Sequences: 438 Number of extensions: 4141 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -