BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1303 (772 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55000.2 68418.m06850 potassium channel tetramerisation domai... 77 2e-14 At5g55000.1 68418.m06849 potassium channel tetramerisation domai... 77 2e-14 At3g09030.1 68416.m01059 potassium channel tetramerisation domai... 48 5e-06 At5g41330.1 68418.m05023 potassium channel tetramerisation domai... 36 0.039 At3g55880.2 68416.m06210 expressed protein 32 0.36 At3g55880.1 68416.m06209 expressed protein 32 0.36 At3g46130.1 68416.m04992 myb family transcription factor (MYB48)... 29 4.5 At3g19170.1 68416.m02434 peptidase M16 family protein / insulina... 28 5.9 At1g23790.1 68414.m03001 expressed protein 28 5.9 At1g74190.1 68414.m08592 leucine-rich repeat family protein cont... 28 7.9 >At5g55000.2 68418.m06850 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein contains Pfam profiles PF02214: K+ channel tetramerisation domain, PF00805: Pentapeptide repeats (8 copies) Length = 298 Score = 76.6 bits (180), Expect = 2e-14 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 4/88 (4%) Frame = +3 Query: 249 TIVKLNVGGTLFYTTIGTLT--KSDNMLRTMFSGRMEVLTDSE-GWILIDRCGKHFGTIL 419 ++V+LN+GG F TTI TLT + D+ML MFSGR + +S+ G++ IDR GKHF IL Sbjct: 9 SMVRLNIGGKKFCTTIDTLTIREPDSMLAAMFSGRHAMCQESKKGYVFIDRDGKHFRHIL 68 Query: 420 NYLRDGTV-ALPDSYKEIMELLAEAKYF 500 N+LRDG + +L D + ELL EA Y+ Sbjct: 69 NWLRDGVIPSLSD--PDCSELLREADYY 94 >At5g55000.1 68418.m06849 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein contains Pfam profiles PF02214: K+ channel tetramerisation domain, PF00805: Pentapeptide repeats (8 copies) Length = 290 Score = 76.6 bits (180), Expect = 2e-14 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 4/88 (4%) Frame = +3 Query: 249 TIVKLNVGGTLFYTTIGTLT--KSDNMLRTMFSGRMEVLTDSE-GWILIDRCGKHFGTIL 419 ++V+LN+GG F TTI TLT + D+ML MFSGR + +S+ G++ IDR GKHF IL Sbjct: 9 SMVRLNIGGKKFCTTIDTLTIREPDSMLAAMFSGRHAMCQESKKGYVFIDRDGKHFRHIL 68 Query: 420 NYLRDGTV-ALPDSYKEIMELLAEAKYF 500 N+LRDG + +L D + ELL EA Y+ Sbjct: 69 NWLRDGVIPSLSD--PDCSELLREADYY 94 >At3g09030.1 68416.m01059 potassium channel tetramerisation domain-containing protein contains Pfam profile PF02214: K+ channel tetramerisation domain Length = 460 Score = 48.4 bits (110), Expect = 5e-06 Identities = 37/99 (37%), Positives = 49/99 (49%), Gaps = 3/99 (3%) Frame = +3 Query: 255 VKLNVGGTLFYTTIGTLTKS--DNMLRTMFSGRMEVLTDSEGWILIDRCGKHFGTILNYL 428 VKLNVGG +F T T+ S D++L + + + + IDR + F ILN L Sbjct: 10 VKLNVGGEIFETNASTIQSSCPDSLLAALSTS----TSHGSNPVFIDRDPEIFAVILNLL 65 Query: 429 RDGTV-ALPDSYKEIMELLAEAKYFLIES*LNLAYRP*P 542 R G + A ELL EA Y+ +ES L LA P P Sbjct: 66 RTGRLPANSSGVFSKQELLDEAMYYGVESLLRLAMLPPP 104 >At5g41330.1 68418.m05023 potassium channel tetramerisation domain-containing protein contains Pfam profile PF02214: K+ channel tetramerisation domain Length = 458 Score = 35.5 bits (78), Expect = 0.039 Identities = 25/87 (28%), Positives = 47/87 (54%) Frame = +3 Query: 252 IVKLNVGGTLFYTTIGTLTKSDNMLRTMFSGRMEVLTDSEGWILIDRCGKHFGTILNYLR 431 +V +NVGG +F TT TL+ + ++ S ++ T++ ++ DR F +L LR Sbjct: 12 VVSINVGGRIFQTTKQTLSLAGT--DSLLS---QLATETTRFV--DRDPDLFSVLLYILR 64 Query: 432 DGTVALPDSYKEIMELLAEAKYFLIES 512 G + ++ +L+ E++Y+ IES Sbjct: 65 TGNLPARSRAFDVRDLIDESRYYGIES 91 >At3g55880.2 68416.m06210 expressed protein Length = 215 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -1 Query: 208 LFQNEEITSTR*YETTSTPGLSTIF-LFQMYLYYILCS 98 L EEI+ TR Y ++ G+ TIF LF M+L +I+ S Sbjct: 3 LISKEEISKTRRYSSSLWRGIKTIFVLFTMFLSFIIFS 40 >At3g55880.1 68416.m06209 expressed protein Length = 198 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -1 Query: 208 LFQNEEITSTR*YETTSTPGLSTIF-LFQMYLYYILCS 98 L EEI+ TR Y ++ G+ TIF LF M+L +I+ S Sbjct: 3 LISKEEISKTRRYSSSLWRGIKTIFVLFTMFLSFIIFS 40 >At3g46130.1 68416.m04992 myb family transcription factor (MYB48) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 256 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 213 RHYFKTKK*HQRDNTKRPVHPDSQLFSCSKCTYTT 109 ++Y++T + KRPV P S +CS + TT Sbjct: 100 KNYWRTHMRKKAQEKKRPVSPTSSFSNCSSSSVTT 134 >At3g19170.1 68416.m02434 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain Length = 1080 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 659 HNNKYSYTSTSDDNLLKNIELFD 727 H+ +SY S D NLLK ++++D Sbjct: 948 HSGVFSYLSYRDPNLLKTLDIYD 970 >At1g23790.1 68414.m03001 expressed protein Length = 518 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 186 HQRDNTKRPVHP 151 H DNTKRPVHP Sbjct: 491 HSADNTKRPVHP 502 >At1g74190.1 68414.m08592 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 965 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 662 NNKYSYTSTSDDNLLKNIELFDKLSLRFSGRV 757 +NK S T D LL N+E+ D + RFSG++ Sbjct: 615 DNKLS--GTIPDTLLANVEILDLRNNRFSGKI 644 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,610,672 Number of Sequences: 28952 Number of extensions: 309055 Number of successful extensions: 710 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -