BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1299X (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 26 0.30 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 25 0.69 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 25 0.69 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 25 0.69 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 25 0.69 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.7 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.5 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 25.8 bits (54), Expect = 0.30 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 291 TACVSIYISIFICL*IYISSLLTAS*NIQH 380 T +S+Y + ICL + S+L + N+ H Sbjct: 272 TPLISLYYGVSICLVTFASALAVVTLNLHH 301 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 24.6 bits (51), Expect = 0.69 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 58 STTQYYVQIYFVQ*NKVMFYSVELRIRNLTRQHFFNAHHYEFSCWL 195 S+ +Y V+ Q +Y LR N ++ F NA H+ WL Sbjct: 103 SSLKYEVEFLLQQ----QWYDPRLRYSNRSQYEFLNAIHHYDDIWL 144 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.6 bits (51), Expect = 0.69 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 58 STTQYYVQIYFVQ*NKVMFYSVELRIRNLTRQHFFNAHHYEFSCWL 195 S+ +Y V+ Q +Y LR N ++ F NA H+ WL Sbjct: 103 SSLKYEVEFLLQQ----QWYDPRLRYSNRSQYEFLNAIHHYDDIWL 144 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.6 bits (51), Expect = 0.69 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 58 STTQYYVQIYFVQ*NKVMFYSVELRIRNLTRQHFFNAHHYEFSCWL 195 S+ +Y V+ Q +Y LR N ++ F NA H+ WL Sbjct: 154 SSLKYEVEFLLQQ----QWYDPRLRYSNRSQYEFLNAIHHYDDIWL 195 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 24.6 bits (51), Expect = 0.69 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 58 STTQYYVQIYFVQ*NKVMFYSVELRIRNLTRQHFFNAHHYEFSCWL 195 S+ +Y V+ Q +Y LR N ++ F NA H+ WL Sbjct: 103 SSLKYEVEFLLQQ----QWYDPRLRYSNRSQYEFLNAIHHYDDIWL 144 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 434 YLNRLRKTSPSRGDFDWE 487 YL RL P +FDW+ Sbjct: 271 YLERLSNDLPHLEEFDWQ 288 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 434 YLNRLRKTSPSRGDFDWE 487 YL RL P +FDW+ Sbjct: 271 YLERLSNDLPYLEEFDWQ 288 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 281 LSRNCMCIYLY 313 ++R C+C YLY Sbjct: 322 VARRCLCEYLY 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,427 Number of Sequences: 438 Number of extensions: 2983 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -