BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1298 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.2 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 2.2 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.2 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 417 WNILFLACN*LTLP*SDALEIF**SFF 337 +NI+ A N L +P ++ LE+F FF Sbjct: 49 YNIISAAVNRLNIPANEILELFGRMFF 75 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 189 CYYANAFEYRAFTLALSLSIPPPQER*TFNAT 94 CY N F + T L + PP + T AT Sbjct: 1346 CYVENTFGHDTVTHQLIVHAPPHSPQITLTAT 1377 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 168 EYRAFTLALSLSIPPPQER*TFNATLLEVALEVSLQKKF 52 EYR + AL S P PQ T + L + ++ Q++F Sbjct: 425 EYRLYNPALIQSQPSPQYPSTSSHILQQPSIRTYTQQQF 463 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 417 WNILFLACN*LTLP*SDALEIF**SFF 337 +NI+ A N L +P ++ LE+F FF Sbjct: 49 YNIISAAVNRLNIPANEILELFGRMFF 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,981 Number of Sequences: 438 Number of extensions: 3036 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -