BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1291 (726 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003271-1|AAO25028.1| 489|Drosophila melanogaster LD17340p pro... 31 1.6 AE014134-1094|AAS64645.1| 489|Drosophila melanogaster CG9526-PB... 31 1.6 AE014134-1093|AAF52384.1| 489|Drosophila melanogaster CG9526-PA... 31 1.6 >BT003271-1|AAO25028.1| 489|Drosophila melanogaster LD17340p protein. Length = 489 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -2 Query: 260 YIDVSNKIMKTKRYVITYCKVYIYTSYVWHTTRL*FLKSFTAFNAQTYVLRL 105 Y ++ +Y + YC +Y+ T+Y+W L + S FN +++V RL Sbjct: 195 YAPTVEATLEKLKYAVFYCALYLATNYMW---PLDYALSDEFFNDRSFVYRL 243 >AE014134-1094|AAS64645.1| 489|Drosophila melanogaster CG9526-PB, isoform B protein. Length = 489 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -2 Query: 260 YIDVSNKIMKTKRYVITYCKVYIYTSYVWHTTRL*FLKSFTAFNAQTYVLRL 105 Y ++ +Y + YC +Y+ T+Y+W L + S FN +++V RL Sbjct: 195 YAPTVEATLEKLKYAVFYCALYLATNYMW---PLDYALSDEFFNDRSFVYRL 243 >AE014134-1093|AAF52384.1| 489|Drosophila melanogaster CG9526-PA, isoform A protein. Length = 489 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -2 Query: 260 YIDVSNKIMKTKRYVITYCKVYIYTSYVWHTTRL*FLKSFTAFNAQTYVLRL 105 Y ++ +Y + YC +Y+ T+Y+W L + S FN +++V RL Sbjct: 195 YAPTVEATLEKLKYAVFYCALYLATNYMW---PLDYALSDEFFNDRSFVYRL 243 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,251,184 Number of Sequences: 53049 Number of extensions: 514397 Number of successful extensions: 1121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3252477558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -