BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1291 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.9 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 6.8 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 301 SILFYVIFYLF*KSTLKSFF*RILIMFSLHVFFIL 405 S L + FYL S K I I+ SLHVFF+L Sbjct: 259 SFLTVLTFYLPSDSGEKVTL-SISILISLHVFFLL 292 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 301 SILFYVIFYLF*KSTLKSFF*RILIMFSLHVFFIL 405 S L + FYL S K I I+ SLHVFF+L Sbjct: 259 SFLTVLTFYLPSDSGEKVTL-SISILISLHVFFLL 292 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 314 MSFSIYFENQHLKVFFKE 367 M FS+ F+N+ L VF E Sbjct: 544 MCFSLKFKNKKLPVFLAE 561 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,082 Number of Sequences: 438 Number of extensions: 3762 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -