BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1284 (847 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0090 - 649631-651162,653189-655019,655313-655365,655731-65... 29 6.2 >08_01_0090 - 649631-651162,653189-655019,655313-655365,655731-655735, 656209-656411,656837-657292,657718-657805,657917-658017, 658404-658631,659128-659445,659528-659812,660148-660711 Length = 1887 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +3 Query: 99 YRQTHCLHNLDRPR*T*IDLDRPSHVNHQSSCGEIKDPIILYGSSK*ITRLHASG-LMVV 275 Y Q DRP T +RPS + + K+P ++ G+ K +R+H SG LM Sbjct: 641 YSQLAAAEPSDRPEWTHQFQERPSSSHRKDDGAANKEPTVVNGAKK--SRIHYSGPLMPP 698 Query: 276 GTKPRE 293 G E Sbjct: 699 GVNMEE 704 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,310,707 Number of Sequences: 37544 Number of extensions: 428399 Number of successful extensions: 626 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -