SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1284
         (847 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0090 - 649631-651162,653189-655019,655313-655365,655731-65...    29   6.2  

>08_01_0090 -
           649631-651162,653189-655019,655313-655365,655731-655735,
           656209-656411,656837-657292,657718-657805,657917-658017,
           658404-658631,659128-659445,659528-659812,660148-660711
          Length = 1887

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = +3

Query: 99  YRQTHCLHNLDRPR*T*IDLDRPSHVNHQSSCGEIKDPIILYGSSK*ITRLHASG-LMVV 275
           Y Q       DRP  T    +RPS  + +      K+P ++ G+ K  +R+H SG LM  
Sbjct: 641 YSQLAAAEPSDRPEWTHQFQERPSSSHRKDDGAANKEPTVVNGAKK--SRIHYSGPLMPP 698

Query: 276 GTKPRE 293
           G    E
Sbjct: 699 GVNMEE 704


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,310,707
Number of Sequences: 37544
Number of extensions: 428399
Number of successful extensions: 626
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 615
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 626
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2350456800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -