BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1284 (847 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98851-3|CAB11538.2| 659|Caenorhabditis elegans Hypothetical pr... 28 9.6 AC087794-8|AAG53698.1| 214|Caenorhabditis elegans Hypothetical ... 28 9.6 >Z98851-3|CAB11538.2| 659|Caenorhabditis elegans Hypothetical protein H12I19.4 protein. Length = 659 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 591 AFCLLGFRIIIHDSH*YFHLF 653 AF L+ ++ IHD+H YFH + Sbjct: 104 AFFLVSNQVFIHDAHQYFHQY 124 >AC087794-8|AAG53698.1| 214|Caenorhabditis elegans Hypothetical protein Y32G9A.10 protein. Length = 214 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 649 FSNDLE*SCKQ*APPNC*CFFSLDLWTSSQPTWCKMVTEPIDIY 780 FSN E +CK+ PP C ++ ++S P + K+V EP D Y Sbjct: 70 FSNKFEQNCKKRVPPRK-CQATVTPFSSRDPKFPKLV-EPSDDY 111 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,658,895 Number of Sequences: 27780 Number of extensions: 391939 Number of successful extensions: 606 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2098003600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -