BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1282 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 3.4 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 7.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.9 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +2 Query: 584 GAGGMAV--SRVPSPLHDGNTPVAENWCFTQV 673 G G AV SR P P HDG + E + +V Sbjct: 203 GQLGAAVDESRTPRPKHDGRGRIVERFTSDRV 234 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 558 GEGAPPPDPPTHSLPEPA 505 G +P PDP PEPA Sbjct: 76 GTTSPEPDPEIPVAPEPA 93 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 333 HWKSFGARLKKDPS*RSG 386 HW G RL +PS R G Sbjct: 21 HWFRRGLRLHDNPSLREG 38 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 457 VSQKCIISKPRAPLG*SW 510 VS +C +SK PL SW Sbjct: 621 VSVQCTVSKGDYPLNISW 638 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,870 Number of Sequences: 336 Number of extensions: 3002 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -