BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1281X (403 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 32 0.038 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 28 0.47 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 27 1.4 SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 4.4 SPCC576.01c ||SPCPB1C11.04c|sulfonate dioxygenase |Schizosacchar... 25 4.4 SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyce... 25 4.4 SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizos... 25 5.8 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 31.9 bits (69), Expect = 0.038 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 93 NITTLKQGYFTSFYHGTIHH*LFIHPQ 13 N TT+ + YF++F+ G IH LF +P+ Sbjct: 31 NNTTISKPYFSTFFEGGIHSLLFFYPK 57 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 28.3 bits (60), Expect = 0.47 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = -3 Query: 368 VSHAAFLASLIAFLRVSASWRRLSSSFM--INTRVTHS 261 ++HA L+S++ +L+VS RR+++ + IN R+T S Sbjct: 1120 INHADILSSILDYLQVSKDKRRMATHILGQINQRLTLS 1157 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 26.6 bits (56), Expect = 1.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 234 APRTYNTQRTDPSVSNVPS 178 +P Y+ RT+P+V+N+PS Sbjct: 393 SPEGYDNNRTNPTVNNLPS 411 >SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.0 bits (52), Expect = 4.4 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 161 FSGDFYITIKIG*PLFGTFCIFSISPH*NK-DISQVFITEQSTISF 27 FSG ++ +K+G PLF + + N +I+Q F+ Q+ +F Sbjct: 308 FSGTVFMRVKVGIPLFERLKVGTNKVKNNSVNIAQSFLEPQTRSTF 353 >SPCC576.01c ||SPCPB1C11.04c|sulfonate dioxygenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 413 Score = 25.0 bits (52), Expect = 4.4 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 124 NHFLAHFVSFQYHHTKTRIFHKF-LSRNNPP 35 N + H ++ Y +TRIFH+ L+ ++PP Sbjct: 372 NRGVTHCITGAYRDDQTRIFHQCNLAASHPP 402 >SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 818 Score = 25.0 bits (52), Expect = 4.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 362 HAAFLASLIAFLRVSASWRRLSSSFMINTRV 270 H +S+IAF++ + WR L SS I V Sbjct: 663 HDESSSSMIAFVKPNPVWRNLGSSLHIEKLV 693 >SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 731 Score = 24.6 bits (51), Expect = 5.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 252 TDDRQPAPRTYNTQRTDPSVSNVP 181 T R P PR NTQ S+S P Sbjct: 517 TSPRTPLPRVKNTQNPSRSISAEP 540 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,594,860 Number of Sequences: 5004 Number of extensions: 29170 Number of successful extensions: 75 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -