BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1281X (403 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 22 7.3 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 22.2 bits (45), Expect = 7.3 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -2 Query: 252 TDDRQPAPRTYNTQRTDPSVSNVPSIDAPAIFGRF 148 T D T T +P + PS D P GR+ Sbjct: 441 TSDAPNHTTTSTTTEGNPGTTRPPSGDGPCAGGRY 475 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 410,763 Number of Sequences: 2352 Number of extensions: 8153 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32067225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -