BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1281X (403 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49127-9|CAA88948.1| 340|Caenorhabditis elegans Hypothetical pr... 52 2e-07 X17497-1|CAA35532.1| 340|Caenorhabditis elegans G-protein protein. 52 2e-07 AF291846-1|AAK55963.1| 340|Caenorhabditis elegans heterotrimeri... 52 2e-07 Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical p... 30 0.71 >Z49127-9|CAA88948.1| 340|Caenorhabditis elegans Hypothetical protein F13D12.7 protein. Length = 340 Score = 51.6 bits (118), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 286 MNELDSLRXDAETLKNAIRDARKAACDTSLAQANSNLEP 402 M+ELD LR +AE LK+ IR+ARK+A DT+LA SNLEP Sbjct: 1 MSELDQLRQEAEQLKSQIREARKSANDTTLATVASNLEP 39 >X17497-1|CAA35532.1| 340|Caenorhabditis elegans G-protein protein. Length = 340 Score = 51.6 bits (118), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 286 MNELDSLRXDAETLKNAIRDARKAACDTSLAQANSNLEP 402 M+ELD LR +AE LK+ IR+ARK+A DT+LA SNLEP Sbjct: 1 MSELDQLRQEAEQLKSQIREARKSANDTTLATVASNLEP 39 >AF291846-1|AAK55963.1| 340|Caenorhabditis elegans heterotrimeric G protein beta subunit1 protein. Length = 340 Score = 51.6 bits (118), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 286 MNELDSLRXDAETLKNAIRDARKAACDTSLAQANSNLEP 402 M+ELD LR +AE LK+ IR+ARK+A DT+LA SNLEP Sbjct: 1 MSELDQLRQEAEQLKSQIREARKSANDTTLATVASNLEP 39 >Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical protein F14F8.13 protein. Length = 328 Score = 29.9 bits (64), Expect = 0.71 Identities = 11/46 (23%), Positives = 30/46 (65%) Frame = -3 Query: 188 MSLRSTLQRFSGDFYITIKIG*PLFGTFCIFSISPH*NKDISQVFI 51 ++++S++ ++ F + I + +FGT C+ S++ + N+++S+ I Sbjct: 142 LNIQSSVHKYLPHFTLCIILKDAVFGTACVLSLAKYLNEEVSEFCI 187 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,008,746 Number of Sequences: 27780 Number of extensions: 174273 Number of successful extensions: 452 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -