BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1281X (403 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79010.1 68414.m09213 NADH-ubiquinone oxidoreductase 23 kDa s... 27 4.7 At1g16700.1 68414.m02000 NADH-ubiquinone oxidoreductase 23 kDa s... 27 4.7 At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein ... 26 8.2 >At1g79010.1 68414.m09213 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (TYKY) identical to SP|Q42599 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI-23KD) (Complex I- 28.5KD) (CI-28.5KD) {Arabidopsis thaliana} Length = 222 Score = 27.1 bits (57), Expect = 4.7 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 301 CPARS*LIHASHTAHVNRRSTTGAAHVQHATHRSFCQQ-CPFD 176 CPA++ I A +RR+T + + FCQ+ CP D Sbjct: 133 CPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVD 175 >At1g16700.1 68414.m02000 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative very strong similarity to SP|Q42599 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI-23KD) (Complex I- 28.5KD) (CI-28.5KD) {Arabidopsis thaliana}; contains Pfam profile PF00037: iron-sulfur cluster-binding protein Length = 222 Score = 27.1 bits (57), Expect = 4.7 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 301 CPARS*LIHASHTAHVNRRSTTGAAHVQHATHRSFCQQ-CPFD 176 CPA++ I A +RR+T + + FCQ+ CP D Sbjct: 133 CPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVD 175 >At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 310 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +1 Query: 259 ELCVTRVL-IMNELDSLRXDAETLK 330 ELC+ R+ +M ELDSLR + ++L+ Sbjct: 97 ELCLNRLQSLMTELDSLRHENDSLR 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,433,714 Number of Sequences: 28952 Number of extensions: 153269 Number of successful extensions: 337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -