BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1280 (850 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 129 3e-30 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 59 4e-09 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 56 3e-08 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_21476| Best HMM Match : Pkinase_C (HMM E-Value=0.001) 53 3e-07 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 47 2e-05 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 44 2e-04 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) 39 0.004 SB_36282| Best HMM Match : HHH (HMM E-Value=7.4) 39 0.006 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.096 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_57685| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.9) 33 0.29 SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.39 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.51 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 32 0.68 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 31 1.2 SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) 31 1.6 SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) 31 1.6 SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36) 30 2.1 SB_28514| Best HMM Match : MazG (HMM E-Value=6) 30 2.7 SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) 30 2.7 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 29 3.6 SB_57211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 29 6.3 SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) 29 6.3 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 29 6.3 SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58802| Best HMM Match : Gag_spuma (HMM E-Value=2.7) 28 8.3 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 129 bits (311), Expect = 3e-30 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = +3 Query: 552 KQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILR 731 K+E+R+ HAQKETEFLRLKRSR+G EDF+ LKVIGRGAFGEVRLVQK+DTGHVYAMKILR Sbjct: 23 KEERRKLHAQKETEFLRLKRSRIGKEDFDSLKVIGRGAFGEVRLVQKQDTGHVYAMKILR 82 Query: 732 KADMLEKEQV 761 KADMLEKEQV Sbjct: 83 KADMLEKEQV 92 Score = 53.2 bits (122), Expect = 3e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 764 HVRAERDILVEADHQWVVKMYYSFQD 841 H RAERDIL EA++QWVVKMYYSFQD Sbjct: 94 HARAERDILAEAENQWVVKMYYSFQD 119 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 74.9 bits (176), Expect = 7e-14 Identities = 34/69 (49%), Positives = 50/69 (72%) Frame = +3 Query: 552 KQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILR 731 + + RQ QKET ++RLKR+++ + FE ++ IG GAFGEV LV+K DT +YAMKILR Sbjct: 629 QSQMRQLLKQKETNYIRLKRTKMDISMFEKIRTIGIGAFGEVWLVRKTDTSMLYAMKILR 688 Query: 732 KADMLEKEQ 758 K+++ + Q Sbjct: 689 KSEVFRRNQ 697 Score = 54.0 bits (124), Expect = 1e-07 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 764 HVRAERDILVEADHQWVVKMYYSFQDPMN 850 HV+AERDIL EAD++WVVK+YYSFQD N Sbjct: 700 HVKAERDILAEADNEWVVKLYYSFQDQEN 728 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +3 Query: 600 RLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVVTFE 773 ++K+ RL EDFEP+ +IG+GAFGEV +V++K + +YAMK L K +ML++ + F+ Sbjct: 67 KIKQFRLHREDFEPICLIGKGAFGEVTVVRQKSSERIYAMKTLNKWEMLKRAETACFK 124 Score = 33.9 bits (74), Expect = 0.17 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 770 RAERDILVEADHQWVVKMYYSFQD 841 + ERD+LV D +W+ ++Y+FQD Sbjct: 124 KEERDVLVYGDKRWITTLHYAFQD 147 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 59.3 bits (137), Expect = 4e-09 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = +3 Query: 603 LKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVVTFE 773 L+R L DF + IGRG FGEV++V+ K TG VYAMK L+K+ L +E V FE Sbjct: 71 LRRLSLSKNDFNVVNTIGRGHFGEVQVVKDKATGDVYAMKTLKKSQTLSEEAVAFFE 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 731 ESRYAGERTGGHVRAERDILVEADHQWVVKMYYSFQD 841 +S+ E ER+I+ A++ W+ + Y+FQD Sbjct: 114 KSQTLSEEAVAFFEEEREIMATANNPWITSLQYAFQD 150 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 603 LKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADML 746 ++ RL +DF+ LKVIGRGAFGEV+LV+ T VYAMK+L K +M+ Sbjct: 62 IQTHRLNNDDFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLSKFEMV 109 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/67 (37%), Positives = 42/67 (62%) Frame = +3 Query: 561 KRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKAD 740 K + H E R ++ ++DF +KV+G+G+FG+V L ++K T VYA+KIL+K Sbjct: 252 KLESHQTSPGERRRHVLRKMTLKDFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKES 311 Query: 741 MLEKEQV 761 +L+ + V Sbjct: 312 VLQDDDV 318 >SB_21476| Best HMM Match : Pkinase_C (HMM E-Value=0.001) Length = 257 Score = 52.8 bits (121), Expect = 3e-07 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 4/75 (5%) Frame = +3 Query: 558 EKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGH----VYAMKI 725 ++R + Q E + K ++G E FE LKV+G+G +G+V LV KK+ GH ++AMK+ Sbjct: 40 DERMETLQLSEETVNPKDEKVGPESFELLKVLGKGGYGKVFLV-KKNHGHSKEKIFAMKV 98 Query: 726 LRKADMLEKEQVVTF 770 L+K + E TF Sbjct: 99 LKKESIFENSLTHTF 113 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/67 (40%), Positives = 42/67 (62%) Frame = +3 Query: 561 KRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKAD 740 KR +KE + LK+ +EDF LKV+G+G+FG+V L + K+T +A+K L+K Sbjct: 265 KRTTSMRKEVAKIELKQWH--IEDFSLLKVLGKGSFGKVLLCELKETKEFFAIKALKKDV 322 Query: 741 MLEKEQV 761 +LE + V Sbjct: 323 VLEDDDV 329 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/45 (48%), Positives = 34/45 (75%) Frame = +3 Query: 627 EDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQV 761 + F+ L+ IG+GAFG+V +VQKKDT +YAMK + K+ ++K+ V Sbjct: 4109 DHFQILRAIGKGAFGKVCIVQKKDTKAMYAMKYMNKSACIKKDAV 4153 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/49 (42%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +3 Query: 615 RLGVEDFEPLKVIGRGAFGEVRLVQKK---DTGHVYAMKILRKADMLEK 752 ++G+E+FE L+V+G GA+G+V L +K+ G ++AMK+L+KA +++K Sbjct: 28 KVGIENFELLRVLGTGAYGKVFLARKRGGHHDGRLFAMKVLKKATIVQK 76 >SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQV 761 +EDFE +K +G G+FG V LVQ K + +AMKIL K +++ +QV Sbjct: 40 LEDFERIKTLGTGSFGRVMLVQHKTSSKYFAMKILDKQKVVKLKQV 85 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +3 Query: 633 FEPLKVIGRGAFGEVRLVQK---KDTGHVYAMKILRKADMLEKEQVVTFEPNGI 785 FE LKV+G+G+FG+V LV+K D G +YAMK+L+KA + ++++ T + I Sbjct: 29 FELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKKATLKVRDRMRTMKERDI 82 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVVTFE 773 ++++E + IG+GA+ R K G YA+KI K E++ +E Sbjct: 235 LDEYEIKEEIGKGAYSSCRRCVNKADGKEYAVKIFEKPKKDPSEEMEAYE 284 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 776 ERDILVEADHQWVVKMYYSF 835 ERDILV+ H ++V++ Y F Sbjct: 79 ERDILVDVQHPFIVRLNYDF 98 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/50 (34%), Positives = 33/50 (66%) Frame = +3 Query: 612 SRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQV 761 S + + +F + V+GRG FG+ L + + T ++A+K L+K D++ +E+V Sbjct: 165 SHMSMSNFRCISVLGRGHFGKAILAEYRTTNELFAIKALKKGDIIAREEV 214 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +3 Query: 603 LKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRK 734 L+R + + F +V+G+G FGEV Q K +G +YAMK L K Sbjct: 75 LERQPVTKKTFRHYRVLGKGGFGEVCACQSKISGKMYAMKKLEK 118 >SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) Length = 465 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/43 (41%), Positives = 29/43 (67%) Frame = +3 Query: 630 DFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQ 758 DF LKVIG+G+FG+V L + K YA+K+L K+ + ++ + Sbjct: 188 DFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNE 230 >SB_36282| Best HMM Match : HHH (HMM E-Value=7.4) Length = 152 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 630 DFEPLKVIGRGAFGEVRLVQKKDTGHVYAMK 722 DF+ L IG+GAFG V VQ K T V+AMK Sbjct: 89 DFQILATIGKGAFGHVLQVQHKSTDEVFAMK 119 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 606 KRSRLGVEDFEPL-KVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVVTFE 773 K+ R+ V F + KVIG G F VR + + T YA+KI+ KA + KE ++ E Sbjct: 10 KKRRVSVHGFYRIGKVIGDGNFAVVRECKHRKTNKEYALKIINKAKVKGKEHMIENE 66 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 34.7 bits (76), Expect = 0.096 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 651 IGRGAFGEVRLVQKKDTGHVYAMKILRK 734 I RGAFGEVRL K T H +A+K++ K Sbjct: 56 IPRGAFGEVRLAFTKGTCHKFAVKLISK 83 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 633 FEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILR 731 +E L+ +GRG FG+V KK T + A+KIL+ Sbjct: 98 YEVLEFLGRGTFGQVVKCWKKGTNELVAIKILK 130 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/45 (37%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 630 DFEPLKVIGRGAFGEV-RLVQKKDTGHVYAMKILRKADMLEKEQV 761 +++ L++IG G+F +V R +++K TG +A K LR D+ +KE++ Sbjct: 30 NYDMLELIGEGSFAKVFRCIERK-TGLEFAAKELRLTDVEDKEKI 73 >SB_57685| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.9) Length = 104 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKIL 728 VE ++ ++ +G GA+GEV+L ++T A+KI+ Sbjct: 5 VEGWDFIETLGEGAYGEVKLAVNRETQEAIAVKII 39 >SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +3 Query: 633 FEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVV 764 +E L+V+G+G+FG+V TG A+KI+R ++ +V Sbjct: 287 YEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALV 330 >SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKIL 728 VE ++ ++ +G GA+GEV+L ++T A+KI+ Sbjct: 5 VEGWDFIETLGEGAYGEVKLAVNRETQEAIAVKII 39 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQ 758 + +FE ++ +G+GA+G L +KKD + +K + D+ E+ Sbjct: 25 ISNFEKIRTVGKGAYGAAVLYRKKDDDSLVILKEITLHDLTGAER 69 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +3 Query: 609 RSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMK 722 +SR+ E FE L+ +G+G FG V V+ K G +YA+K Sbjct: 577 KSRIKSE-FEQLEFLGKGGFGNVIKVRNKLDGGLYAIK 613 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +3 Query: 612 SRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRK 734 ++L + ++ + +G G FG+V+L + TGH A+KIL + Sbjct: 13 NKLAIGNYNLGETLGVGTFGKVKLAVHQLTGHKVAIKILNR 53 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +3 Query: 633 FEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQ 758 ++ + +IG+G FG LV+ + + +YA+K L M +++ Sbjct: 4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDR 45 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +3 Query: 627 EDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADML 746 E + LK IG+GAFG V++ +++ +K +RKA +L Sbjct: 584 EKYLTLKSIGKGAFGFVQMARRRADMSEVVVKFIRKAKIL 623 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 648 VIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQV 761 + G G FG V L + + G YA+KI+ ++++ +QV Sbjct: 46 IYGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQV 83 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 31.5 bits (68), Expect = 0.89 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 645 KVIGRGAFGEVRLVQKKDTGHVYAMKILRKAD 740 +VIGRG FG+V V K TG V +K L D Sbjct: 950 EVIGRGFFGQVMKVTHKTTGEVMVLKELINYD 981 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +3 Query: 627 EDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKE 755 E +E + +G+GAF VR ++T YA+KIL +M +++ Sbjct: 15 EKYELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRD 57 >SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMK 722 +E FE L IG G++G V + K+TG + A+K Sbjct: 1 MERFEKLGKIGEGSYGVVFKCRHKETGQIVAIK 33 >SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMK 722 +E FE L IG G++G V + K+TG + A+K Sbjct: 1 MERFEKLGKIGEGSYGVVFKCRHKETGQIVAIK 33 >SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36) Length = 454 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 549 QKQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEV 677 +++E+R+ + E + EDF LKV+G+G+FG+V Sbjct: 251 REEEERKCRQKLEQSLSDPNAKKFRPEDFHFLKVLGKGSFGKV 293 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 672 EVRLVQKKDTGHVYAMKILRKADMLEKEQV 761 +V L ++K T VYA+K+L+K +++ + V Sbjct: 346 QVMLAERKGTDQVYAIKVLKKDVIVQDDDV 375 >SB_28514| Best HMM Match : MazG (HMM E-Value=6) Length = 137 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 630 DFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVV 764 D++ ++ IG G +GEV V+ TG + A K++ +LEK + V Sbjct: 56 DWQLVESIGEGTYGEVYKVRNVKTGEIAAAKVI--DSILEKIEEV 98 >SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) Length = 424 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 630 DFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVV 764 D++ ++ IG G +GEV V+ TG + A K++ +LEK + V Sbjct: 56 DWQLVESIGEGTYGEVYKVRNVKTGEIAAAKVI--DSILEKIEEV 98 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/45 (24%), Positives = 29/45 (64%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQ 758 ++++E ++++GRGA+G V L ++ + +K + +M ++E+ Sbjct: 1 MQNYEKVRIVGRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEER 45 >SB_57211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = +3 Query: 642 LKVIGRGAFGEVR--LVQ--KKDTGHVYAMKILR 731 +KVIG+GAFG V +VQ K+ G V A+K+LR Sbjct: 41 VKVIGKGAFGLVAKGIVQLSGKNEGSVVALKMLR 74 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = +3 Query: 573 HAQKETEFLR---LKRSRLGVED-FEPLKVIGRGAFGEVRLVQKKDTGHVYAMKIL 728 +AQK T+ +R +K + E F L+ IG+G+FGEV T V A+KI+ Sbjct: 788 NAQKATKKIRDRIMKGMKADPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKII 843 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 245 LALGNIFRVRVYPKTEPCLGGKAPRALRWPQ 337 LA ++R+RVY + +GG A + LR P+ Sbjct: 3280 LAGFTVYRIRVYSANDDLVGGYASKTLRTPE 3310 >SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) Length = 310 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 645 KVIGRGAFGEVRLVQKKDTGHVYAMK 722 K++G GAFG+V + DTG A+K Sbjct: 194 KLLGAGAFGQVYMCHDLDTGRELAVK 219 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 624 VED-FEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRK 734 +ED +E +V+GRG+FG V + +TG +A+K + K Sbjct: 23 IEDVYEFGQVLGRGSFGVVNEAKHIETGTRWAIKAVNK 60 >SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 624 VEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMK 722 +E +E L ++G G++G V + KD+ + A+K Sbjct: 111 MEKYENLGLVGEGSYGMVMKCRHKDSNQIVAIK 143 >SB_58802| Best HMM Match : Gag_spuma (HMM E-Value=2.7) Length = 810 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 621 GVEDFEPLKVIGRGAFGEV 677 G++DF+ +K I RGAFG V Sbjct: 54 GIDDFDIIKPISRGAFGVV 72 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,778,919 Number of Sequences: 59808 Number of extensions: 559022 Number of successful extensions: 3500 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 3352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3497 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -