BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1274 (799 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1261 + 25266976-25267169,25267275-25268235,25268335-252684... 30 2.5 06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724,344... 30 2.5 02_05_1133 + 34346894-34347121,34347222-34347283,34347373-343474... 29 4.3 01_06_0568 + 30305008-30305170,30305277-30305341,30306599-303067... 28 7.5 >07_03_1261 + 25266976-25267169,25267275-25268235,25268335-25268430, 25269154-25269290,25269394-25269601 Length = 531 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -3 Query: 731 RRFSYYLYFLLTISL--IIFQVHFKTDDIHN 645 R+F+ L + +SL I F+VHFKT D HN Sbjct: 397 RKFANSLTIAVALSLGWITFEVHFKTTDEHN 427 >06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724, 3444823-3444900,3444980-3445075,3445363-3445405, 3445498-3445571,3445693-3445781,3445887-3445935, 3446171-3446227,3446309-3446425,3448633-3448698, 3449140-3449196,3449271-3449363,3449515-3449662, 3449753-3449902,3449979-3450181,3450319-3450438, 3450530-3450694,3450784-3450870,3450951-3451100, 3451225-3451365,3451399-3451569,3452015-3452091, 3452175-3452415,3452495-3452758,3452913-3453000, 3453099-3453481 Length = 1170 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 527 RPQTTIVFLICVLYDSREKIYDPLLTMKLIT 619 RPQ + FLIC+ DS E IYD L +I+ Sbjct: 243 RPQLSSCFLICMKDDSIEGIYDTLKECAVIS 273 >02_05_1133 + 34346894-34347121,34347222-34347283,34347373-34347460, 34348005-34348268,34348346-34348586,34348672-34348748, 34348837-34349007,34349084-34349176,34349257-34349406, 34349491-34349577,34349656-34349820,34349900-34350019, 34350244-34350446,34350547-34350696,34350779-34350926, 34351046-34351129,34351207-34351308 Length = 810 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 527 RPQTTIVFLICVLYDSREKIYDPL 598 RPQ + FLIC+ DS E IYD L Sbjct: 212 RPQLSSCFLICMNDDSIEGIYDTL 235 >01_06_0568 + 30305008-30305170,30305277-30305341,30306599-30306769, 30307409-30307978,30308085-30308444,30308496-30308774 Length = 535 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 609 SLLQHAFCNWYWIVNIIGLEVYLKDN 686 ++L+ A C W W VN++ L+ + + N Sbjct: 390 NVLESARCAWSWGVNVVNLDAWRRTN 415 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,441,960 Number of Sequences: 37544 Number of extensions: 284279 Number of successful extensions: 351 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -