BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1273 (779 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schi... 27 3.0 SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar ... 26 5.3 >SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 970 Score = 27.1 bits (57), Expect = 3.0 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 160 VLAISYLKVEISCLSRRCIQCRSRGELGSCGD-LYPLI 270 V+ YL+ +I C SR C CRS+ S G+ L P++ Sbjct: 33 VVREQYLRNDIPCQSRACPLCRSKLPKDSRGNVLEPIL 70 >SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar membrane transporter Hmt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 830 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 545 IFIFIKNYIY*STLITLSSILCYC 616 ++ FIK IY TLI L LCYC Sbjct: 397 VYFFIKFDIY-FTLIVLIMTLCYC 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,362,027 Number of Sequences: 5004 Number of extensions: 72779 Number of successful extensions: 172 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -