BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1269 (742 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33432| Best HMM Match : 7tm_1 (HMM E-Value=1e-15) 31 1.3 SB_23117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_33432| Best HMM Match : 7tm_1 (HMM E-Value=1e-15) Length = 278 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 445 KQKESVRRGGHIKGKTKL*FLLIPSIFIVFYFLNLFWTSTNNL--RPKLAKSVQPFSN 612 KQ R I+GKT FLL+ SIFI+ + ++ T T + RP L PF++ Sbjct: 179 KQTRDGARRASIEGKTINVFLLVVSIFILSWAPIIYMTITEYIASRPDLIPHQLPFAS 236 >SB_23117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 593 RSSRSRILARLTNSNSFIYSFIYIDFRNSEPRRSKNETNIFFNSGTK 733 R SRSR + ++ +S IY+ + F +S+ ++ +E + SGT+ Sbjct: 59 RFSRSRDVGQVLSSEDAIYADYDLIFASSDTQKRSSENKMLVFSGTQ 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,113,418 Number of Sequences: 59808 Number of extensions: 408793 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -