BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1269 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 4.0 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 7.0 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.0 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 22.6 bits (46), Expect = 4.0 Identities = 11/43 (25%), Positives = 16/43 (37%) Frame = +1 Query: 535 YFLNLFWTSTNNLRPKLAKSVQPFSNFSETNEQQFIYIFIHLY 663 ++L W NLR + K + +T I HLY Sbjct: 88 FYLGKEWKKNLNLRDSVTKYLIHLKEIEDTEPILLIAYIYHLY 130 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 547 LFWTSTNNLRPKLAKSVQPFSNFSETNEQQFIY 645 LF+ +L K+ K+V P S + ++F Y Sbjct: 282 LFYYQLTDLYKKIKKAVPPLSLHGQLLWREFFY 314 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 623 LTNSNSFIYSFIYIDF 670 LTNS IY + YID+ Sbjct: 25 LTNSLKVIYEWKYIDY 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,221 Number of Sequences: 438 Number of extensions: 4558 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -