BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1267 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosacch... 29 0.50 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 25 8.1 >SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 29.5 bits (63), Expect = 0.50 Identities = 19/74 (25%), Positives = 35/74 (47%) Frame = -1 Query: 417 INSFIMFFNSSLFVFKGL*RIFILCVVMPRYGSTIRAVARSSYSDSSRGVIPIGSSCGAL 238 I SF+ ++ F+FKGL +LC + P+ R V + +S G++P+ + Sbjct: 339 IGSFVFYWFPG-FIFKGLSYFTVLCWIWPKN----RVVNQLFGYNSGLGILPLTFDWQQV 393 Query: 237 AFQGKTLIQQPFWI 196 + L P+W+ Sbjct: 394 VYNSNPL-ASPWWV 406 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 25.4 bits (53), Expect = 8.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 511 FRDHIYRYLRIFDKKA 558 FR +Y+YL+I DKK+ Sbjct: 883 FRKRVYKYLKIKDKKS 898 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,913,271 Number of Sequences: 5004 Number of extensions: 60002 Number of successful extensions: 149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -