BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1267 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0754 + 27803143-27803517,27805441-27806832,27806910-278071... 30 2.1 01_05_0691 + 24330491-24332269 30 2.1 >04_04_0754 + 27803143-27803517,27805441-27806832,27806910-27807164, 27807246-27807368,27807643-27808119,27808217-27808603 Length = 1002 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/78 (29%), Positives = 37/78 (47%) Frame = +2 Query: 317 VDPYLGITTHKMNIRYRPLKTNKEELKNIIKEFIHTQDYNKAYSKLANGEWIPRHFSKNK 496 VDP L HK+ I Y+P +T +L +I E + D + A+G RH + Sbjct: 261 VDPEL----HKITISYKPDQTGPRDLIEVI-ESAASGDLTVSIYPEADGRQQHRHGEIKR 315 Query: 497 HQQTSFETIFIVIYEFLT 550 ++Q+ ++ I FLT Sbjct: 316 YRQSFLWSLVFTIPVFLT 333 >01_05_0691 + 24330491-24332269 Length = 592 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/71 (22%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = -1 Query: 405 IMFFNSSLF-VFKGL*RIFILCVVMPRYGSTIRAVARSSYSDSSRGVIPIGSSCGALAFQ 229 ++ F+ LF V+K R+F+LCV + + A Y++ V +G+ + Sbjct: 160 VILFDQGLFTVYK---RLFVLCVALNAAAVALAASGHFPYAERRAAVFAMGNILALTLCR 216 Query: 228 GKTLIQQPFWI 196 + ++ FW+ Sbjct: 217 SEAALRVVFWL 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,544,814 Number of Sequences: 37544 Number of extensions: 318155 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -