BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1267 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 24 5.4 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 24 5.4 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 24 5.4 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 9.5 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.5 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.8 bits (49), Expect = 5.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 231 QGKTLIQQPFWIHK 190 +G+TL + FW+HK Sbjct: 118 EGETLCDKAFWLHK 131 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 23.8 bits (49), Expect = 5.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 231 QGKTLIQQPFWIHK 190 +G+TL + FW+HK Sbjct: 118 EGETLCDKAFWLHK 131 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 23.8 bits (49), Expect = 5.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 231 QGKTLIQQPFWIHK 190 +G+TL + FW+HK Sbjct: 118 EGETLCDKAFWLHK 131 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +2 Query: 239 SAPQDEPMGMTPRELSEYDDLATALIVDPYLGITTHKMNIRY 364 S P G+T ++ + D+ LI + +L + + MN+R+ Sbjct: 29 SDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNVRW 70 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +2 Query: 239 SAPQDEPMGMTPRELSEYDDLATALIVDPYLGITTHKMNIRY 364 S P + G+T +++ + D+ LI + +L + + N+R+ Sbjct: 46 SDPLEVKFGLTLQQIIDVDEKNQLLITNIWLSLEWNDYNLRW 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,562 Number of Sequences: 2352 Number of extensions: 15016 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -