BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1266 (816 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 29 4.5 SB_36662| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_51990| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1055 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 682 LYMYILAHKYRLYICLYCVIVFYI 611 L +Y + H RLYIC++ + F I Sbjct: 154 LVIYTMLHSLRLYICIFITVAFSI 177 >SB_36662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = -1 Query: 177 VLGVTFLHIVCSCSNYIRIYHEIT*RRVFLFIR*THSLPSVEW 49 +LG+TF+ ++ SC + ++ + FL++ T + S+ W Sbjct: 131 ILGITFIFVLLSCIIAFELMTSLSAYQQFLYLMVTFFMLSIPW 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,803,323 Number of Sequences: 59808 Number of extensions: 332700 Number of successful extensions: 644 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -