BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1266 (816 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031632-1|CAA21004.1| 248|Caenorhabditis elegans Hypothetical ... 29 4.0 Z99102-2|CAB11775.1| 499|Caenorhabditis elegans Hypothetical pr... 28 9.2 U40421-2|AAA81438.1| 453|Caenorhabditis elegans Hypothetical pr... 28 9.2 >AL031632-1|CAA21004.1| 248|Caenorhabditis elegans Hypothetical protein Y32B12B.1 protein. Length = 248 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 700 YKCLYLHIITMFNLVDQIEFIKTQSLFKTKYS 795 Y+CL+L +I + NL F+K F+T +S Sbjct: 21 YRCLWLFLIMLKNLETSKTFLKAAQNFRTPFS 52 >Z99102-2|CAB11775.1| 499|Caenorhabditis elegans Hypothetical protein B0331.1 protein. Length = 499 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 697 NYKCLYLHIITMFNLVDQIEFIKTQSLFK 783 N K + +HI+ F L ++EF +T+ LF+ Sbjct: 457 NEKVMLIHILRNFKLEPKLEFYETKPLFE 485 >U40421-2|AAA81438.1| 453|Caenorhabditis elegans Hypothetical protein C02B8.5 protein. Length = 453 Score = 27.9 bits (59), Expect = 9.2 Identities = 29/114 (25%), Positives = 48/114 (42%) Frame = -3 Query: 628 VIVFYIYYCTIVSLVQPLSTYDRTT*NYRTINIYNSCSKNGH*SEPNTSFSAAHLVAASH 449 V ++Y+Y TIV V P+ I++ S S N S+ T L + + Sbjct: 99 VRIYYVYMYTIVMAVGPVLLLIVIN-TAIVISMRRSSSPNSE-SDIITLVLVVCLFISCN 156 Query: 448 TLTLRIQFIYLNLLLVNSID*QIKSIHKIYKTSMKVLIELLY*RNDCRTPRSVV 287 L L + F+ L ++NS + ++ + +S LI + N RT R V Sbjct: 157 VLPLTVNFLELLFGIINSYLIDLSNLMVVVNSSCNFLIYYTFGSNFRRTLRYYV 210 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,078,844 Number of Sequences: 27780 Number of extensions: 264248 Number of successful extensions: 518 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2008899418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -