BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1264 (694 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 31 0.007 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 31 0.007 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 25 0.59 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 25 0.78 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.1 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.6 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 31.5 bits (68), Expect = 0.007 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 324 FNIYCCHTLRN*KVFSKKVTLYVPLKYL 241 +NIY C T+ N + F +K+ L + L YL Sbjct: 195 YNIYVCQTVSNFEYFQRKILLMIQLYYL 222 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 31.5 bits (68), Expect = 0.007 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 324 FNIYCCHTLRN*KVFSKKVTLYVPLKYL 241 +NIY C T+ N + F +K+ L + L YL Sbjct: 121 YNIYVCQTVSNFEYFQRKILLMIQLYYL 148 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 25.0 bits (52), Expect = 0.59 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 450 YRPGCAAIESVSSFLDG 400 Y PGCA ++S S+ L G Sbjct: 382 YLPGCAMVDSCSNILTG 398 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 24.6 bits (51), Expect = 0.78 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = -3 Query: 428 LKVSRAFWTASAADIV--FC--LDVVRFPTVILNFEIPCLIFIVATP 300 LK + A A+AA+ V FC LD ++I+N +PC+ +VA P Sbjct: 293 LKDTEAEVRAAAANKVKDFCQNLDKAHQESIIMNNILPCVKELVADP 339 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 402 GLSS*HRLLFGCCKIPDCHLEF 337 G+++ H FG PDC +EF Sbjct: 346 GMAAPHHQNFGPRHPPDCSMEF 367 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 45 SVRNHCLIHSLYTLCKQLMYISAC 116 SV +I+ YTL K +++ S C Sbjct: 162 SVHEASIINFGYTLAKFMIFTSTC 185 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,306 Number of Sequences: 336 Number of extensions: 2892 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -