BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1260 (769 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0033 - 19437746-19437916,19438063-19438145,19438266-194383... 28 9.4 06_03_1479 + 30428488-30428502,30428619-30428715,30429627-304299... 28 9.4 >11_06_0033 - 19437746-19437916,19438063-19438145,19438266-19438359, 19438478-19438551,19438825-19438861,19440767-19440844, 19440927-19441022,19441719-19441815,19441910-19442015, 19442136-19442208,19442537-19442680,19443241-19443681 Length = 497 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 725 AFRMNFKIKDVTRTWSSRVLSVRPEGRIPSSNTRLSWQ 612 AFR+ +KDV + + +R GRI + T+LSW+ Sbjct: 191 AFRLGAVLKDVLDRFLPDDVHIRCNGRIRVAITQLSWR 228 >06_03_1479 + 30428488-30428502,30428619-30428715,30429627-30429904, 30430256-30431032,30431254-30431343,30431538-30431605, 30431696-30431789,30431902-30431961 Length = 492 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 719 RMNFKIKDVTRTWSSRVLSVRPEGRI 642 R +F DVT+TW ++ ++P GR+ Sbjct: 281 RFDFDPLDVTKTWPEDIIPLQPVGRM 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,642,832 Number of Sequences: 37544 Number of extensions: 270123 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -