BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1260 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 25 1.0 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 3.1 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 4.1 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 7.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 7.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 7.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 7.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 7.2 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 21 9.5 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 143 KIVFNNRTKLYTELYTQIIYRNYNNMISINYSRI 244 KI+ NN + Y Y NYNN + NY ++ Sbjct: 80 KIISNNNSLSNNYNYNNN-YNNYNNNYNTNYKKL 112 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 598 ELVTHCHDNRVLEEGILPSGRTLST 672 E V HCH N V+ + P L++ Sbjct: 20 ESVHHCHHNGVVHRDLKPENLLLAS 44 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 94 YNNYNNNYNTNYKKL 108 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 167 KLYTELYTQIIYRNYNNMISINYS 238 K+ + L Y NYNN + NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 167 KLYTELYTQIIYRNYNNMISINYS 238 K+ + L Y NYNN + NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 167 KLYTELYTQIIYRNYNNMISINYS 238 K+ + L Y NYNN + NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 167 KLYTELYTQIIYRNYNNMISINYS 238 K+ + L Y NYNN + NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYN 103 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 200 YRNYNNMISINYSRI 244 Y NYNN + NY ++ Sbjct: 337 YNNYNNNYNNNYKKL 351 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 80 ILFVLNNIFLKCSLG 124 +LF+ N +F C LG Sbjct: 11 LLFIFNFVFAVCGLG 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,484 Number of Sequences: 438 Number of extensions: 4047 Number of successful extensions: 20 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -