BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1258 (742 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyce... 27 2.8 SPBC16G5.05c |||MSP domain|Schizosaccharomyces pombe|chr 2|||Manual 27 3.7 SPAC18G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 4.9 SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 26 6.5 SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe... 25 8.6 SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex su... 25 8.6 >SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 27.1 bits (57), Expect = 2.8 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 29 VTQRICKLFTYIRCLKCKFCSVLYNLLAVTSGW 127 V+ RI ++F + +KC CSV+++ + S + Sbjct: 240 VSNRIVRIFFLLSAMKCLGCSVIWHTFSSLSNY 272 >SPBC16G5.05c |||MSP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 383 Score = 26.6 bits (56), Expect = 3.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 436 VFSELKTMSPTHYCKRDDLTKQDVKISLMLQFQLK 540 V ++KT +P HYC R + K + K ++ +Q L+ Sbjct: 33 VIFKVKTTAPKHYCVRPNSGKIEPKSTVNVQVLLQ 67 >SPAC18G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 114 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/57 (22%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 742 QILDLIDPFFSSCTHLEVMNG-CIKWRSKILA*CISVKVNGFLHAYASASSLVIFIK 575 +++D ++ C + + NG C WR +IL +V + G + Y + +K Sbjct: 22 ELVDSVNCVADLCHAIWMFNGGCADWRLQILKEGFTVPMTGIISQYLKTDDHIKIVK 78 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 25.8 bits (54), Expect = 6.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 632 SKWFFACICICQFTSYFYK 576 +KWFF C+C +F K Sbjct: 14 TKWFFCCVCTILTMPFFKK 32 >SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 182 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 633 LTEMHYARILLRHLIHPFITSKWVQLEKKGS 725 L + + A I+ RHLI P+IT +++ K S Sbjct: 127 LPKFNGATIIYRHLIRPYITPHVIRICKSVS 157 >SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex subunit Mtr4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1117 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 Query: 347 GISSFNFSFHNCWSVFTNSLKCLQVELKLSILGNHYFS 234 GIS F C+ F NSL+ ++E KL HY S Sbjct: 646 GISP-EFMLERCFFQFQNSLEVPKLEAKLEESQQHYDS 682 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,021,234 Number of Sequences: 5004 Number of extensions: 60108 Number of successful extensions: 137 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -