BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1256 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33) 30 2.3 SB_22673| Best HMM Match : FixQ (HMM E-Value=7.6) 28 7.2 >SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33) Length = 942 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 120 TIQFVFRRSNIIMSEFSKLVFMYIIEEDIRS 28 TI + + SNI M++ LVF+Y+ E D+++ Sbjct: 483 TINLLPQSSNIAMTQNGNLVFLYVTEADLKT 513 >SB_22673| Best HMM Match : FixQ (HMM E-Value=7.6) Length = 184 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -3 Query: 540 PVII*FDISLT-----RNIFIVLSSFVFYYYLINTY-ICLNTLLTTSIKN 409 PV++ F +S+ R + + + S V+Y+YL Y IC+ T + S N Sbjct: 57 PVVVVFGLSMLPVTVFRLVMVYIPSLVYYHYLFVLYNICMITTVINSSAN 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,485,734 Number of Sequences: 59808 Number of extensions: 321130 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -