BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1256 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 25 0.77 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.8 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.0 bits (52), Expect = 0.77 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 323 NKKNLSINYYRSNVIKNNTLNCFINRMFEFFIDVVN 430 N N NY +N NN N + N + + +++N Sbjct: 325 NNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIIN 360 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 459 INTYICLNTLLTTSIKNSNILLMK 388 ++T I + LLT K+SN+L K Sbjct: 46 VHTGILIKALLTVQAKDSNVLAAK 69 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,007 Number of Sequences: 438 Number of extensions: 3433 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -