BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1254 (806 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 30 1.6 At1g65550.1 68414.m07436 xanthine/uracil permease family protein... 29 4.8 At3g11560.3 68416.m01412 expressed protein 28 6.3 At3g11560.2 68416.m01411 expressed protein 28 6.3 At3g11560.1 68416.m01410 expressed protein 28 6.3 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 700 KLNLESPKKSVTFKIYDDNNNINLYGRCAKT 792 ++ +E K F +Y NN I+LYG C KT Sbjct: 134 QIQVEVLKHGFDFDVYVGNNLIHLYGTCKKT 164 >At1g65550.1 68414.m07436 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 541 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -2 Query: 346 VPTYL*MNKLIRELELFKFEFTEIRLCIYLPHLFSNLFSAPGFYDIAKGSTQ 191 +P +L M K + L+ + + + LCI L LF+ L ++ G YD +TQ Sbjct: 213 LPRFLKMKKGVMILDGSRCDRYGMILCIPLVWLFAQLLTSSGVYDHKSHTTQ 264 >At3g11560.3 68416.m01412 expressed protein Length = 872 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 685 PSPKSKLNLESPKKSVTFKIYDDNNNINL 771 P P+S NLE + S T + D+NN+ L Sbjct: 85 PQPRSSSNLEDMRTSFTGSLQDENNSNGL 113 >At3g11560.2 68416.m01411 expressed protein Length = 872 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 685 PSPKSKLNLESPKKSVTFKIYDDNNNINL 771 P P+S NLE + S T + D+NN+ L Sbjct: 85 PQPRSSSNLEDMRTSFTGSLQDENNSNGL 113 >At3g11560.1 68416.m01410 expressed protein Length = 619 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 685 PSPKSKLNLESPKKSVTFKIYDDNNNINL 771 P P+S NLE + S T + D+NN+ L Sbjct: 85 PQPRSSSNLEDMRTSFTGSLQDENNSNGL 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,905,677 Number of Sequences: 28952 Number of extensions: 286348 Number of successful extensions: 552 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -