BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1253 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 27 0.76 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 26 1.3 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 24 4.1 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 9.4 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 9.4 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 26.6 bits (56), Expect = 0.76 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +2 Query: 164 PALESKISTFQIKDLSRK-EKTRVKEGQVYLPKNFQIDLQKTQKRSGNGITSGDIKKLEE 340 P S+IST + + K + + +K + +P Q+ + + G ++GD + + Sbjct: 218 PESVSRISTGPVVQVDNKLQPSAIKNSIMSIPPRRQMTGKPGPTIATGGASTGDAAEEID 277 Query: 341 AGYHTVESVAYAPKNG*SQLKGYLKRRQ 424 HTVE +A A +K ++ RQ Sbjct: 278 LMGHTVEELAAAANVSVEVIKEAIRVRQ 305 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 25.8 bits (54), Expect = 1.3 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = +2 Query: 164 PALESKISTFQIKDLSRK-EKTRVKEGQVYLPKNFQIDLQKTQKRSGNGITSGDIKKLEE 340 P S+IST + + K + + +K + +P Q+ + + T+GD + + Sbjct: 211 PESVSRISTGPVVQVDNKLQPSAIKNSIMSIPPRRQMTGKPGPTIATGSATTGDAAEEID 270 Query: 341 AGYHTVESVAYAPKNG*SQLKGYLKRRQ 424 HTVE +A A +K ++ RQ Sbjct: 271 LMGHTVEELAAAANVSVEVIKEAIRVRQ 298 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 307 AIARTFLCLLEIYLKILRQINLTL 236 A+ R F CLLE+ L+ + Q+ + L Sbjct: 227 ALLRIFECLLEVTLQKILQLTIVL 250 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 397 IKGISEAKADKILAEASKLVPMGFTTATE 483 + +A+ DK+ A S P+G TA+E Sbjct: 10 LNAYKDAQKDKVTATMSHGAPVGTKTASE 38 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 397 IKGISEAKADKILAEASKLVPMGFTTATE 483 + +A+ DK+ A S P+G TA+E Sbjct: 10 LNAYKDAQKDKVTATMSHGAPVGTKTASE 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 682,620 Number of Sequences: 2352 Number of extensions: 13187 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -