BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1249 (752 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0778 + 7111562-7112152,7113034-7113157,7113252-7113395,711... 28 9.2 >12_01_0778 + 7111562-7112152,7113034-7113157,7113252-7113395, 7113485-7113630,7113716-7113838,7113922-7114089, 7114253-7114474,7114572-7114745 Length = 563 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -2 Query: 409 GRIINRVHVRGSHFTDIVFFFYYLTKANVIQCCHKNFGTPPNVIS*TF-FVNVIQNKKLE 233 G + +R+ RG H+T+ T +V+Q CHKN ++ F + N +N L+ Sbjct: 168 GELFDRIVARG-HYTERAAAAVMRTIMDVVQHCHKNGVMHRDLKPENFLYANASENSPLK 226 Query: 232 TI 227 I Sbjct: 227 VI 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,046,028 Number of Sequences: 37544 Number of extensions: 308368 Number of successful extensions: 522 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -