BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1248 (800 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U48508-1|AAC51191.1| 5038|Homo sapiens skeletal muscle ryanodine... 31 4.8 J05200-1|AAA60294.1| 5032|Homo sapiens RYR1 protein. 31 4.8 >U48508-1|AAC51191.1| 5038|Homo sapiens skeletal muscle ryanodine receptor protein. Length = 5038 Score = 31.1 bits (67), Expect = 4.8 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 164 HKSPPCLIVSLQKYLALQAPTHRSQFLPIFCVNYDALTLNPSIIFDFGLSKQD 6 H SPPC + +L A +AP S +P+ + AL + + D G +D Sbjct: 1776 HFSPPCFVAALPAAGAAEAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARD 1828 >J05200-1|AAA60294.1| 5032|Homo sapiens RYR1 protein. Length = 5032 Score = 31.1 bits (67), Expect = 4.8 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 164 HKSPPCLIVSLQKYLALQAPTHRSQFLPIFCVNYDALTLNPSIIFDFGLSKQD 6 H SPPC + +L A +AP S +P+ + AL + + D G +D Sbjct: 1775 HFSPPCFVAALPAAGAAEAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARD 1827 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,838,418 Number of Sequences: 237096 Number of extensions: 2378140 Number of successful extensions: 3291 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3291 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9869080686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -