BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1246 (680 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 1.7 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 25 2.9 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 24 3.9 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 24 3.9 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.9 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 8.9 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 8.9 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 25.4 bits (53), Expect = 1.7 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 314 PSTINGVKTTIIYPATDKHIAKFSQQEVHIVLETPELYKKLTLP-HLEKEQFNLQWV 481 P+T N + I+ P T + K S EV V + EL L HL KEQ WV Sbjct: 313 PTTQNKPRPGIVAPTTIPTVPKKSLAEVGKVYDRCELANDLLHKFHLPKEQV-ATWV 368 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 24.6 bits (51), Expect = 2.9 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -2 Query: 367 LISGWVDYCSFHTVYSRRRETLEVSVNIVL 278 L GW Y FH+++++ T+ + + + L Sbjct: 123 LTYGWAWYIMFHSIFAQICHTISIWLTVTL 152 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.2 bits (50), Expect = 3.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 537 TFIVMYNSIFSLLPSRMLY 481 TF+V+ F LLP R+LY Sbjct: 4 TFLVVLELAFFLLPGRVLY 22 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.2 bits (50), Expect = 3.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 537 TFIVMYNSIFSLLPSRMLY 481 TF+V+ F LLP R+LY Sbjct: 4 TFLVVLELAFFLLPGRVLY 22 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 551 NPSFSLLLSCTILSSHFYLLECCTPTVN*T 462 +P FSL + TIL + ++ TPTV T Sbjct: 151 HPLFSLFIITTILVNCILMIMPTTPTVEST 180 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 340 SFHTVYSRRRETLEVSVNIVLE 275 S+++VYSR LE ++LE Sbjct: 356 SYYSVYSRNNCELECEAKLILE 377 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 340 SFHTVYSRRRETLEVSVNIVLE 275 S+++VYSR LE ++LE Sbjct: 356 SYYSVYSRNNCELECEAKLILE 377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,545 Number of Sequences: 2352 Number of extensions: 13854 Number of successful extensions: 66 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -