BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1244X (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0109 + 19126849-19126917,19129883-19130620 28 5.3 01_06_1514 - 37892552-37893074,37893291-37893367,37893471-378935... 27 7.0 10_01_0344 - 3777610-3777758,3777870-3777959,3778950-3779025,377... 27 9.2 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 27 9.2 05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 27 9.2 >11_05_0109 + 19126849-19126917,19129883-19130620 Length = 268 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 426 VNKICIKGILATPDFSHTGELQTLNMKLVMPW 521 +NKI KG + +PD S L+ +N PW Sbjct: 192 INKILTKGAVMSPDSSIRDVLREINAHCKKPW 223 >01_06_1514 - 37892552-37893074,37893291-37893367,37893471-37893587, 37893826-37893926,37895077-37895146,37895318-37895415, 37896326-37896419,37896792-37896882,37897222-37897547, 37898193-37898278,37899078-37899417 Length = 640 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 321 VFKAASIPVDFESFFFSEVNPTLSAPLEDVVNSIAVNK 434 V +++SIP + + + PT+ + L VNS VN+ Sbjct: 403 VSRSSSIPPNTRDALYQSLPPTVKSSLRSKVNSFVVNE 440 >10_01_0344 - 3777610-3777758,3777870-3777959,3778950-3779025, 3779206-3779288,3780456-3780799,3782064-3782113, 3782406-3782542,3782692-3782776 Length = 337 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +3 Query: 246 KGRRIKCTLIPGDGVGPELVYAVQEVFKAASIPVDFESFFFSEVNPTLSA 395 KG+ IKC G G LV EV A + V + F S + LSA Sbjct: 21 KGKPIKCKAAVAHGPGEALVMEEVEVAPPARMEVRLKVLFTSICHTDLSA 70 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 384 TLSAPLEDVVNSIAVNKI-CIKGILATPDFSHTGELQTLNMKLVMP 518 T L D +N I +KG LA DFS GE++ + L P Sbjct: 1125 TFEKVLSDEINKEVAQTIQMLKGKLAQDDFSALGEIRKTVLNLTAP 1170 >05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 Length = 1007 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 253 LPLLPSVAIWTLLKIAGLQMVHNIHFSPLLPNL 155 LPLLPS + + AG ++ +H LP+L Sbjct: 756 LPLLPSTLVELKISEAGFSVLPEVHAPRFLPSL 788 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,219,778 Number of Sequences: 37544 Number of extensions: 303397 Number of successful extensions: 626 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -