BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1243 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 26 0.28 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 4.6 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 4.6 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 4.6 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 22 6.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 8.0 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 26.2 bits (55), Expect = 0.28 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 154 CTTKSKHGDMLTMHY--TGTLDDGHKFDSSYDRDQPLRSK 267 CT K K G +HY D ++ ++ YD+D R K Sbjct: 78 CTEKQKEGSRKIIHYLIDNKRDWWNELEAKYDKDGVYRQK 117 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 650 MKPFLSLSSCWKI 612 MKP LSL + WK+ Sbjct: 1 MKPLLSLVTLWKL 13 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -3 Query: 322 THMSSKPWSHPLITCPTPIWNVKVDRDHNSSRTCVRRLACQC 197 TH+ + + + L+ T + K D + + +RRL QC Sbjct: 54 THLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQC 95 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -3 Query: 322 THMSSKPWSHPLITCPTPIWNVKVDRDHNSSRTCVRRLACQC 197 TH+ + + + L+ T + K D + + +RRL QC Sbjct: 54 THLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQC 95 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 184 LTMHYTGTLDDGHKFDSSYD 243 L +HY + D HK+ + YD Sbjct: 12 LFVHYGWSEDTTHKYTTKYD 31 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 103 GPEVTELKTEVVSVPEGCT 159 GP++TEL+ E + + T Sbjct: 282 GPQITELEPETIESQDAIT 300 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 103 GPEVTELKTEVVSVPEGCT 159 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 103 GPEVTELKTEVVSVPEGCT 159 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 514 SLFAGEHVVLIGVDFLEHVCGRWRVTDVDQLHFEM 410 S+F G V++ V CG VT + HF++ Sbjct: 178 SVFFGNKPVILTVVLPLLACGVMVVTHITMAHFKI 212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,565 Number of Sequences: 336 Number of extensions: 3602 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -