BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1241 (1005 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 188 5e-48 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 188 5e-48 SB_56| Best HMM Match : Actin (HMM E-Value=0) 188 5e-48 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 188 5e-48 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 188 5e-48 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 113 2e-25 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 104 1e-22 SB_54| Best HMM Match : Actin (HMM E-Value=0) 101 1e-21 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 9e-17 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 61 2e-09 SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) 56 5e-08 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 44 3e-04 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 42 6e-04 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 42 8e-04 SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.052 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 36 0.052 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_13217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.068 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 35 0.091 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 35 0.091 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 35 0.12 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 35 0.12 SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 34 0.16 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 34 0.16 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_783| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 34 0.21 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.28 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_47452| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 33 0.28 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.28 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) 33 0.28 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 33 0.37 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 33 0.48 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 33 0.48 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) 33 0.48 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) 33 0.48 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 33 0.48 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_27752| Best HMM Match : ASC (HMM E-Value=3.7e-07) 33 0.48 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 33 0.48 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) 33 0.48 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.64 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 32 0.64 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.64 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.64 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.64 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.64 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.64 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 32 0.64 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.64 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.64 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.64 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 32 0.64 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 32 0.64 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.64 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.64 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 32 0.64 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.64 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.64 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 32 0.64 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 32 0.64 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 32 0.64 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 32 0.64 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 32 0.64 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 32 0.64 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 32 0.64 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.64 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 32 0.64 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 32 0.64 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 32 0.64 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 32 0.64 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 32 0.64 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 32 0.64 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 32 0.64 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 32 0.64 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 32 0.64 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 32 0.64 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.64 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 32 0.64 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 32 0.64 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 32 0.64 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 32 0.64 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 32 0.64 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 32 0.64 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 32 0.64 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.64 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 32 0.64 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 32 0.64 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 32 0.64 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 32 0.64 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 32 0.64 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 188 bits (459), Expect = 5e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 433 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR 511 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 122 bits (295), Expect = 3e-28 Identities = 56/68 (82%), Positives = 63/68 (92%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYAL Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL 172 Query: 661 PHAILRLD 684 PHAI+RLD Sbjct: 173 PHAIIRLD 180 Score = 71.3 bits (167), Expect = 1e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 147 MCDEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 M D+E+AALVVDNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 1 MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 188 bits (459), Expect = 5e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 433 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 95 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR 511 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 96 VAPEEHPVLLTEAPLNPKANREKMTQ 121 Score = 123 bits (297), Expect = 2e-28 Identities = 57/68 (83%), Positives = 63/68 (92%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYAL Sbjct: 112 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL 171 Query: 661 PHAILRLD 684 PHAILRLD Sbjct: 172 PHAILRLD 179 Score = 68.5 bits (160), Expect = 8e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 153 DEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 +++VAALVVDNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 188 bits (459), Expect = 5e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 433 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 95 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR 511 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 96 VAPEEHPVLLTEAPLNPKANREKMTQ 121 Score = 123 bits (297), Expect = 2e-28 Identities = 57/68 (83%), Positives = 63/68 (92%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYAL Sbjct: 112 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL 171 Query: 661 PHAILRLD 684 PHAILRLD Sbjct: 172 PHAILRLD 179 Score = 69.7 bits (163), Expect = 3e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 153 DEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 ++EVAALVVDNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 188 bits (459), Expect = 5e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 433 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR 511 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 123 bits (297), Expect = 2e-28 Identities = 57/68 (83%), Positives = 63/68 (92%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYAL Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL 172 Query: 661 PHAILRLD 684 PHAILRLD Sbjct: 173 PHAILRLD 180 Score = 75.8 bits (178), Expect = 5e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 147 MCDEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 MCD++VAALVVDNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 188 bits (459), Expect = 5e-48 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 433 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR 511 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 99 bits (238), Expect = 3e-21 Identities = 48/61 (78%), Positives = 54/61 (88%), Gaps = 2/61 (3%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE--GY 654 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYE GY Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEERGY 172 Query: 655 A 657 + Sbjct: 173 S 173 Score = 71.3 bits (167), Expect = 1e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 147 MCDEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 M D+++AALV+DNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 119 bits (287), Expect = 3e-27 Identities = 54/60 (90%), Positives = 60/60 (100%) Frame = +1 Query: 505 DQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 684 ++IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI+RLD Sbjct: 83 EKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLD 142 Score = 113 bits (272), Expect = 2e-25 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 254 GRPRHQGVMVGMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 418 GRPRHQGVMVGMG KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI TF Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90 Score = 69.7 bits (163), Expect = 3e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 153 DEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 D++VAALV+DNGSGMCKAGFAG DAPRAVFPSIV P Sbjct: 2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 113 bits (272), Expect = 2e-25 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +1 Query: 511 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 684 IMFE FN+PA+YVAIQAVLSLYASGRTTG+V DSGDGVSH VPIYEGYALPHAILRLD Sbjct: 1 IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVPIYEGYALPHAILRLD 58 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 104 bits (249), Expect = 1e-22 Identities = 42/68 (61%), Positives = 60/68 (88%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P+ + + ++ FETFN PA+++++QAVLSLYA+GRTTG+VLD+GDGVSH+VPIYEG+A+ Sbjct: 138 PRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGVSHSVPIYEGFAM 197 Query: 661 PHAILRLD 684 PH+I+R D Sbjct: 198 PHSIMRTD 205 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 446 EHPVLLTEAPLNPKANREK 502 +HPVLLTEAPLNP+ NREK Sbjct: 126 QHPVLLTEAPLNPRRNREK 144 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 101 bits (241), Expect = 1e-21 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = +1 Query: 508 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 684 Q+MFE+FN P MYVA+QAV++LYASGRTTG V D GDGVSHTVP+Y+GY LPHA R+D Sbjct: 2166 QLMFESFNVPCMYVAVQAVMALYASGRTTGTVFDCGDGVSHTVPVYDGYWLPHATQRID 2224 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 398 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTRSCSKHSTRPPC 544 K+W H F ++LRV E+ PVLLTEAPLNPK NRE+M + + S PC Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFE-SFNVPC 2176 Score = 45.2 bits (102), Expect = 8e-05 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 Query: 171 LVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 +V+DNGSG CKAG + ++PR VFP+IV P Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRP 2127 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 85.0 bits (201), Expect = 9e-17 Identities = 36/68 (52%), Positives = 49/68 (72%) Frame = +1 Query: 481 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 660 P + + ++MFE + +Y+AIQAVL+LYA G TG+V+DSGDGV+H P+YEG+AL Sbjct: 116 PMKNREKMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGDGVTHICPVYEGFAL 175 Query: 661 PHAILRLD 684 PH RLD Sbjct: 176 PHLTRRLD 183 Score = 82.2 bits (194), Expect = 6e-16 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = +2 Query: 296 KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEA 472 KD VGDEA R +L + YP+++GIV NWDDM+ +W +TF +++ + P VLLTE Sbjct: 53 KDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEP 112 Query: 473 PLNPKANREKM 505 PLNP NREKM Sbjct: 113 PLNPMKNREKM 123 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 165 AALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGPAIRA*WSVWD 293 + +V DNG+G K G+AG + P +FPS+V P IR+ V D Sbjct: 7 SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGD 49 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 60.9 bits (141), Expect = 2e-09 Identities = 24/57 (42%), Positives = 41/57 (71%) Frame = +1 Query: 508 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 678 ++MFE +N PA ++ +VL+ +A+GR+ G+V+DSG + VP+++GY L AI+R Sbjct: 54 ELMFEKYNVPAFFLCKNSVLTAFANGRSNGLVIDSGATQTSAVPVHDGYVLQQAIVR 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +2 Query: 356 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 508 PI+ G++ +WD EKI + + ++ HP+L++EA N + REK+T Sbjct: 3 PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLT 53 >SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) Length = 372 Score = 56.0 bits (129), Expect = 5e-08 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = +2 Query: 284 GMGXKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 463 G+ D ++GDEA K T K+PI H IV +WD ME+ W + LR PE+H LL Sbjct: 278 GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336 Score = 32.3 bits (70), Expect = 0.64 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +1 Query: 592 TGIVLDSGDGVSHTVPI 642 TG V+DSGDGV+H +P+ Sbjct: 356 TGCVIDSGDGVTHVIPV 372 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +3 Query: 156 EEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 E LV+D GS M K GFAG DAP+ VFP IV P Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRP 1389 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 502 DDQIMFETFNTPAMYVAIQAVLSLYASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAI 672 D+ I ++ T A+ + S RT TG V+DSGDGV+H +P+ EGY + I Sbjct: 31 DEAIDKPSYATKAVLALAASWTSRQVGERTLTGCVIDSGDGVTHVIPVAEGYVIGSCI 88 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +1 Query: 556 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 684 Q LSLYASG T G+ L SG + IYEG+ L H + L+ Sbjct: 767 QLSLSLYASGMTLGVCLSSGFSCTQAAVIYEGHTLNHTLQTLE 809 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +3 Query: 141 FKMCDEEVAALVVDNGSGMCKAGFAGXDAPRAVFPSIVEGP 263 FK+ A+V+DNG G+ K GFAG PR + P++V P Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNP 733 >SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.9 bits (84), Expect = 0.013 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 251 DRGEHGARSIXSCETGLAHTGAIVYYQRGNFFV 153 D GE+G+ SI S ETGLAHTGAI+ Q + V Sbjct: 7 DGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = -2 Query: 110 INKLTCYCTASLLLCSCRIPA---APGDPLVLERPPP 9 + +L YC S CR+P+ +PGDPLVLERPPP Sbjct: 38 VARLARYCMRSPD-AHCRVPSNSCSPGDPLVLERPPP 73 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.030 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -2 Query: 110 INKLTCYCTASLLLCSCRIPAAPGDPLVLERPPP 9 IN + T + +L + I PGDPLVLERPPP Sbjct: 48 INVASIISTTTSVLITIIISCIPGDPLVLERPPP 81 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 62 CRIPAAPGDPLVLERPPP 9 C++P+ PGDPLVLERPPP Sbjct: 33 CKVPS-PGDPLVLERPPP 49 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 35.9 bits (79), Expect = 0.052 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 110 INKLTCYCTASLLLCSCRIPAAPGDPLVLERPPP 9 I K C L+ S +PGDPLVLERPPP Sbjct: 187 IAKQMTICVFFLMYSSSSNSCSPGDPLVLERPPP 220 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 35.9 bits (79), Expect = 0.052 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 59 RIPAAPGDPLVLERPPP 9 R+ A+PGDPLVLERPPP Sbjct: 319 RVIASPGDPLVLERPPP 335 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 35.9 bits (79), Expect = 0.052 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 6/71 (8%) Frame = +1 Query: 484 QGQQREDDQIMFETFNTPAMYVAIQAVLSLY------ASGRTTGIVLDSGDGVSHTVPIY 645 +G + D+I+FE +N A+ A LS Y S +V+D+G +H VP++ Sbjct: 315 EGLEDAMDEILFEEYNFKALSRTTAAQLSAYKCHQDMVSKNPVCLVVDTGYSFTHIVPVF 374 Query: 646 EGYALPHAILR 678 G + A+ R Sbjct: 375 NGKVIKKAVRR 385 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 305 YVGDEAQSKRGILTLKY--PIEHGIVTNWDDMEKIWHHTFYNE 427 ++GD+ + + L Y P + G + NWD ++IW +TF E Sbjct: 273 FIGDQIEECKDYSALFYVLPFQKGFLVNWDVEKQIWDYTFGKE 315 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.068 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 + S+++ S +PGDPLVLERPPP Sbjct: 25 FTLGSVIIASLSNSCSPGDPLVLERPPP 52 >SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.068 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -2 Query: 80 SLLLCSCRI--PAAPGDPLVLERPPP 9 S+ L S R P +PGDPLVLERPPP Sbjct: 16 SIFLASSRKSPPRSPGDPLVLERPPP 41 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.068 Identities = 16/23 (69%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 71 LCSCRIP--AAPGDPLVLERPPP 9 +CS RI +PGDPLVLERPPP Sbjct: 27 ICSYRISNSCSPGDPLVLERPPP 49 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.5 bits (78), Expect = 0.068 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 Query: 74 LLCSCRIPAAPGDPLVLERPPP 9 L CS +PGDPLVLERPPP Sbjct: 4 LHCSLSNSCSPGDPLVLERPPP 25 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.068 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = -2 Query: 74 LLCSCRIP--AAPGDPLVLERPPP 9 ++C C + +PGDPLVLERPPP Sbjct: 28 IICICTVSNSCSPGDPLVLERPPP 51 >SB_13217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.068 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -2 Query: 56 IPAAPGDPLVLERPPP 9 IP PGDPLVLERPPP Sbjct: 20 IPRRPGDPLVLERPPP 35 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 AAPGDPLVLERPPP Sbjct: 513 AAPGDPLVLERPPP 526 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 35.1 bits (77), Expect = 0.091 Identities = 26/94 (27%), Positives = 35/94 (37%), Gaps = 5/94 (5%) Frame = +2 Query: 404 WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRP 583 + H Y + P H T P P + R KH + P PS P S Sbjct: 170 YKHPSYPTYNIPPTPH----TSIPPTPHTSIPPTPRPTYKHPSYPSYKHPSYPSSHIQAS 225 Query: 584 VVPPVSC----WTPAT-VSPTPCPSTRDTHSPTP 670 ++P + P T + PTP P T +PTP Sbjct: 226 LLPHIQASLLPLIPNTSIPPTPTPHTSIPPTPTP 259 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.091 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 89 CTASLLLCSCRIPAAPGDPLVLERPPP 9 CT L SC +PGDPLVLERPPP Sbjct: 7 CTQELTSNSC----SPGDPLVLERPPP 29 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 35.1 bits (77), Expect = 0.091 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 YC+A ++ +PGDPLVLERPPP Sbjct: 81 YCSAECVMTISN-SCSPGDPLVLERPPP 107 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.091 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 71 LCSCRIPAAPGDPLVLERPPP 9 +C+ +PGDPLVLERPPP Sbjct: 18 ICAASNSCSPGDPLVLERPPP 38 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 59 RIPAAPGDPLVLERPPP 9 RI +PGDPLVLERPPP Sbjct: 99 RIALSPGDPLVLERPPP 115 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.1 bits (77), Expect = 0.091 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 68 CSCRIP--AAPGDPLVLERPPP 9 CSC+ +PGDPLVLERPPP Sbjct: 25 CSCQSSNSCSPGDPLVLERPPP 46 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/74 (28%), Positives = 27/74 (36%) Frame = +2 Query: 452 PVLLTEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT 631 P T P P T T P SP+ P P P + TP T +PT Sbjct: 29 PTPTTHTPTKPSPTTPTSTAPTQTTPT-PTTPSPTAPTQTTPTPATPTPTTPTPKTPTPT 87 Query: 632 PCPSTRDTHSPTPS 673 T+ T + TP+ Sbjct: 88 TSTLTKPTPATTPT 101 Score = 34.3 bits (75), Expect = 0.16 Identities = 21/75 (28%), Positives = 28/75 (37%), Gaps = 1/75 (1%) Frame = +2 Query: 452 PVLLTEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP- 628 P T P P T S T +P+KP P P + TP +P Sbjct: 69 PTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPK 128 Query: 629 TPCPSTRDTHSPTPS 673 TP P+T + TP+ Sbjct: 129 TPTPTTPTPTAHTPT 143 Score = 31.9 bits (69), Expect = 0.84 Identities = 20/72 (27%), Positives = 26/72 (36%) Frame = +2 Query: 452 PVLLTEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT 631 P T P P T++ +T P T K + T + P TP PT Sbjct: 49 PTQTTPTPTTPSPTAP--TQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPT 106 Query: 632 PCPSTRDTHSPT 667 P T T +PT Sbjct: 107 PTAHTPTTPTPT 118 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 5/68 (7%) Frame = +2 Query: 482 PKANREKMTRSCSK--HSTRPPCTSP--SKPCSRCTRPVVPPVSCWTPATVSP-TPCPST 646 P+ + T+ C+ H+T+PP T P +KP + R PP + P T P T P T Sbjct: 121 PRTTKPHTTKPCTTKPHTTKPPTTKPQTTKPHTTKPRTTKPPTT--KPHTTKPHTTKPHT 178 Query: 647 RDTHSPTP 670 H+ P Sbjct: 179 TKPHTTKP 186 Score = 29.5 bits (63), Expect = 4.5 Identities = 23/86 (26%), Positives = 30/86 (34%), Gaps = 1/86 (1%) Frame = +2 Query: 464 TEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCP 640 T P N K K R+ H+T+P T P T+P P T P T P Sbjct: 23 TTKPHNIKLYTTK-PRTTKPHTTKPHTTKPHTIKPHTTKPHTTKPHTTKPHTTKPRTTKP 81 Query: 641 STRDTHSPTPSCVWTLXGRDLHRLPH 718 T H+ P + + PH Sbjct: 82 QTTKPHTTKPHTIKLYTTKPKTTKPH 107 Score = 29.1 bits (62), Expect = 5.9 Identities = 20/70 (28%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Frame = +2 Query: 464 TEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVS-PTPCP 640 T P K K R+ H+T+P T P T+P P T PT P Sbjct: 108 TNKPYTTKPRTTK-PRTTKPHTTKPCTTKPHTTKPPTTKPQTTKPHTTKPRTTKPPTTKP 166 Query: 641 STRDTHSPTP 670 T H+ P Sbjct: 167 HTTKPHTTKP 176 >SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 140 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P +PGDPLVLERPPP Sbjct: 19 PRSPGDPLVLERPPP 33 >SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 89 CTASLLLCSCRIPAAPGDPLVLERPPP 9 C + C + PGDPLVLERPPP Sbjct: 50 CKTIVRTCKTIVRDIPGDPLVLERPPP 76 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +2 Query: 536 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 673 PP P P + TRP VP +T PTP P T P P+ Sbjct: 919 PPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPA 964 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 2427 SPGDPLVLERPPP 2439 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -2 Query: 89 CTASLLLCSCRIPAAPGDPLVLERPPP 9 C+ ++L SC +PGDPLVLERPPP Sbjct: 15 CSRTVLSNSC----SPGDPLVLERPPP 37 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 TA LL SC +PGDPLVLERPPP Sbjct: 3 TAILLSNSC----SPGDPLVLERPPP 24 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 + T+ L + S +PGDPLVLERPPP Sbjct: 23 HTTSYLTIHSASNSCSPGDPLVLERPPP 50 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 T+SL++ +PGDPLVLERPPP Sbjct: 2 TSSLVIRYISNSCSPGDPLVLERPPP 27 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -2 Query: 140 LVFN*IVLL*INKLTCYCTASLLLCSCRIP---AAPGDPLVLERPPP 9 ++ ++ + I +T T ++ + + R+ PGDPLVLERPPP Sbjct: 278 IIITTVISIIITHITTTSTIAIFIINRRVHKGCTGPGDPLVLERPPP 324 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P PGDPLVLERPPP Sbjct: 89 PKGPGDPLVLERPPP 103 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 89 CTA-SLLLCSCRIPAAPGDPLVLERPPP 9 CT+ L + S +PGDPLVLERPPP Sbjct: 28 CTSRQLSITSTSNSCSPGDPLVLERPPP 55 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 TA L+ +PGDPLVLERPPP Sbjct: 6 TAPLMFTDPSNSCSPGDPLVLERPPP 31 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 524 HSTRP-PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC 637 H+T P P T PS P C + P C+T T+SP PC Sbjct: 665 HTTHPSPATHPS-PSQPCPATHLSPKPCFTFVTLSPKPC 702 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 539 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC 637 PC SPS P + P C+T T+SP PC Sbjct: 510 PCFSPSNPSPASH---LSPKPCFTSLTLSPKPC 539 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/39 (51%), Positives = 23/39 (58%), Gaps = 5/39 (12%) Frame = -2 Query: 110 INKLTCYCTA---SLLLC--SCRIPAAPGDPLVLERPPP 9 +NKLT C S+L S +PGDPLVLERPPP Sbjct: 2 VNKLTEMCAVRDTSILSAGRSLSNSCSPGDPLVLERPPP 40 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P PGDPLVLERPPP Sbjct: 130 PETPGDPLVLERPPP 144 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 +CTA + C PGDPLVLERPPP Sbjct: 249 HCTAQDRI-QCFKMGGPGDPLVLERPPP 275 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 155 VAHLELVFN*IVLL*INKLTCYCTASLLLCSCRIP--AAPGDPLVLERPPP 9 V + V N ++ L +N + C C I +PGDPLVLERPPP Sbjct: 38 VTQVRTVENFLLALFVNHVGRSCEVVYQHFPCLISNSCSPGDPLVLERPPP 88 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 34.3 bits (75), Expect = 0.16 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +2 Query: 434 VAPEEHPVLLTEAPLNPKANREKMTR-SCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWT 610 V P++ P + PL K ++E T C + P + S+P S TR +T Sbjct: 559 VVPKKIPYIPALRPLTTKPHKEFTTHLHCILSALSTPVLNTSRPKSARTRAWSVSPRLYT 618 Query: 611 PATVSPTPCPSTRDTHSPTPS 673 P +++P S R T S PS Sbjct: 619 PKSITPKFILSPRQTLSAPPS 639 >SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P PGDPLVLERPPP Sbjct: 16 PEVPGDPLVLERPPP 30 >SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P +PGDPLVLERPPP Sbjct: 47 PFSPGDPLVLERPPP 61 >SB_783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 65 SCRIPAAPGDPLVLERPPP 9 + RI PGDPLVLERPPP Sbjct: 56 AARIRQIPGDPLVLERPPP 74 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 11 VAAALELVDPPGLQEF 58 VA ALELVDPPGLQEF Sbjct: 54 VAPALELVDPPGLQEF 69 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 71 LCSCRIPAAPGDPLVLERPPP 9 LC +PGDPLVLERPPP Sbjct: 166 LCPYSGSTSPGDPLVLERPPP 186 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 59 RIPAAPGDPLVLERPPP 9 RI PGDPLVLERPPP Sbjct: 576 RIAINPGDPLVLERPPP 592 >SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 Y T+ L +PGDPLVLERPPP Sbjct: 48 YWTSLFALKVAHATKSPGDPLVLERPPP 75 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C+ +PGDPLVLERPPP Sbjct: 9 CALSNSCSPGDPLVLERPPP 28 >SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 2 CEASNSCSPGDPLVLERPPP 21 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = -2 Query: 71 LCSCRIPA---APGDPLVLERPPP 9 L S IP+ +PGDPLVLERPPP Sbjct: 8 LISANIPSNSCSPGDPLVLERPPP 31 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 6 CEASNSCSPGDPLVLERPPP 25 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 89 CTASLLLCSCRIPAAPGDPLVLERPPP 9 C SL SC +PGDPLVLERPPP Sbjct: 2 CHVSLSSNSC----SPGDPLVLERPPP 24 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = -2 Query: 71 LCSCRIPA---APGDPLVLERPPP 9 L S IP+ +PGDPLVLERPPP Sbjct: 8 LISANIPSNSCSPGDPLVLERPPP 31 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 71 LCSCRIPAAPGDPLVLERPPP 9 +C +PGDPLVLERPPP Sbjct: 42 ICHTSNSCSPGDPLVLERPPP 62 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 71 LCSCRIPAAPGDPLVLERPPP 9 +C +PGDPLVLERPPP Sbjct: 13 ICFTSNSCSPGDPLVLERPPP 33 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 59 RIPAAPGDPLVLERPPP 9 ++ A PGDPLVLERPPP Sbjct: 179 QLSANPGDPLVLERPPP 195 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 5/32 (15%) Frame = -2 Query: 89 CTASLLLC--SCRIPA---APGDPLVLERPPP 9 C L LC +P+ +PGDPLVLERPPP Sbjct: 28 CNKMLGLCLKQANVPSNSCSPGDPLVLERPPP 59 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 +A++L SC +PGDPLVLERPPP Sbjct: 10 SANILSNSC----SPGDPLVLERPPP 31 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 63 AGPGDPLVLERPPP 76 >SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 65 SCRIPAAPGDPLVLERPPP 9 S R +PGDPLVLERPPP Sbjct: 39 SSRRKKSPGDPLVLERPPP 57 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 5 CKLSNSCSPGDPLVLERPPP 24 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 APGDPLVLERPPP Sbjct: 20 APGDPLVLERPPP 32 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 2 CDISNSCSPGDPLVLERPPP 21 >SB_47452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 32 AGPGDPLVLERPPP 45 >SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -2 Query: 83 ASLLLCSCRIPAAPGDPLVLERPPP 9 +++L+ + A PGDPLVLERPPP Sbjct: 225 STVLVFQPKYCARPGDPLVLERPPP 249 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 92 YCTASLLLCSCRIPAA-PGDPLVLERPPP 9 Y T+ + +C+ PGDPLVLERPPP Sbjct: 66 YVTSLYIRDTCKYGVTRPGDPLVLERPPP 94 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 12 CDISNSCSPGDPLVLERPPP 31 >SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 27 ACPGDPLVLERPPP 40 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 S C +PGDPLVLERPPP Sbjct: 5 SFASCFASNSCSPGDPLVLERPPP 28 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 Y + L+ + +PGDPLVLERPPP Sbjct: 5 YTAGTNLVTASSNSCSPGDPLVLERPPP 32 >SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 53 PAAPGDPLVLERPPP 9 P PGDPLVLERPPP Sbjct: 166 PIDPGDPLVLERPPP 180 >SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) Length = 310 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 56 IPAAPGDPLVLERPPP 9 I ++PGDPLVLERPPP Sbjct: 189 INSSPGDPLVLERPPP 204 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 TA L SC +PGDPLVLERPPP Sbjct: 58 TAKKLSNSC----SPGDPLVLERPPP 79 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C I PGDPLVLERPPP Sbjct: 21 CRGGIHNGPGDPLVLERPPP 40 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 33.1 bits (72), Expect = 0.37 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 524 HSTRPPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPCPSTRDTHSPTPS 673 HST ++PS P + CT P P P + TP+T S PST T S TPS Sbjct: 63 HSTPSAPSTPSTPSTPCT-PSTPSTPSTPSTPSTPSTPSAPSTPSTPS-TPS 112 Score = 29.9 bits (64), Expect = 3.4 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = +2 Query: 521 KHSTRPPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPC-PSTRDTHSP--TPS 673 K+ R ++PS PC+ T P P P + TP+T S TPC PST T S TPS Sbjct: 2 KNPHRLKLSTPSTPCTPST-PSTPSTPSTPRTPSTPS-TPCTPSTPSTPSTPITPS 55 Score = 29.1 bits (62), Expect = 5.9 Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 473 PLNPKANREKMTRSC-SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTR 649 P+ P T S S ST ++PS P + CT P P TP+T S PST Sbjct: 240 PITPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPCT-PNTPS----TPSTPSMPSTPSTP 294 Query: 650 DTHSPTPS 673 T S TPS Sbjct: 295 STPS-TPS 301 Score = 29.1 bits (62), Expect = 5.9 Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 473 PLNPKANREKMTRSC-SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTR 649 P+ P T S S ST ++PS P + CT P P TP+T S PST Sbjct: 790 PITPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPCT-PNTPS----TPSTPSMPSTPSTP 844 Query: 650 DTHSPTPS 673 T S TPS Sbjct: 845 STPS-TPS 851 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 536 PPCTSP-SKPCSRCTRPVVPPVSCWTPATVSPTP-CPSTRDTHSPTPS 673 P TSP + P +R P+ PP C + V PTP S++ + SP+PS Sbjct: 316 PAFTSPPNTPTTRTFSPISPPAGC-AASPVPPTPPAISSKRSFSPSPS 362 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -2 Query: 71 LCSCRIPA-APGDPLVLERPPP 9 LC R + +PGDPLVLERPPP Sbjct: 25 LCRSRSNSCSPGDPLVLERPPP 46 >SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 65 SCRIPAAPGDPLVLERPPP 9 S IP GDPLVLERPPP Sbjct: 4 SLSIPHTTGDPLVLERPPP 22 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 1899 AIPGDPLVLERPPP 1912 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 95 CYCTASLLLCSCRIPAAPGDPLVLERPPP 9 CY + SC +PGDPLVLERPPP Sbjct: 180 CYTDLVIQSNSC----SPGDPLVLERPPP 204 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 89 CTASLLLCSCRIPAAPGDPLVLERPPP 9 C SL L + +PGDPLVLERPPP Sbjct: 2 CHVSLSLRASN-SCSPGDPLVLERPPP 27 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 ++PGDPLVLERPPP Sbjct: 367 SSPGDPLVLERPPP 380 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.48 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = -2 Query: 107 NKLTCYCTASLLLCSCRIPAAPGDPLVLERPPP 9 N T + T S CS PGDPLVLERPPP Sbjct: 3 NAFTIFRTISSNSCS------PGDPLVLERPPP 29 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 56 IPAAPGDPLVLERPPP 9 + +PGDPLVLERPPP Sbjct: 81 VELSPGDPLVLERPPP 96 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 ++PGDPLVLERPPP Sbjct: 432 SSPGDPLVLERPPP 445 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C PGDPLVLERPPP Sbjct: 50 CKTTASEFPGDPLVLERPPP 69 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 220 ANPGDPLVLERPPP 233 >SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 293 AHPGDPLVLERPPP 306 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 74 LLCSCRIPAAPGDPLVLERPPP 9 LL +PGDPLVLERPPP Sbjct: 17 LLAPTSNSCSPGDPLVLERPPP 38 >SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 77 LLLCSCRIPAAPGDPLVLERPPP 9 L+ +C +PGDPLVLERPPP Sbjct: 18 LIKRTCDPWQSPGDPLVLERPPP 40 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 95 CYCTASLLLCSCRIPA-APGDPLVLERPPP 9 C C + C + +PGDPLVLERPPP Sbjct: 148 CECRMEGINCEVGSNSCSPGDPLVLERPPP 177 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 74 LLCSCRIPAAPGDPLVLERPPP 9 L S +PGDPLVLERPPP Sbjct: 8 LFYSASNSCSPGDPLVLERPPP 29 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 32.7 bits (71), Expect = 0.48 Identities = 27/80 (33%), Positives = 32/80 (40%), Gaps = 14/80 (17%) Frame = +2 Query: 464 TEAPLNPKANR------EKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATV- 622 TEA +PKAN+ K T+ C PP P C+ P PPV PA + Sbjct: 1336 TEAGKHPKANKVGKDKHNKGTKKCYGACAPPPMADP---CATMAAPCAPPVMMAAPAPML 1392 Query: 623 ------SPTPC-PSTRDTHS 661 P PC P THS Sbjct: 1393 APMLAPMPAPCAPPECHTHS 1412 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 1198 SPGDPLVLERPPP 1210 >SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) Length = 187 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 68 ANPGDPLVLERPPP 81 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 +A+++ SC +PGDPLVLERPPP Sbjct: 10 SANIISNSC----SPGDPLVLERPPP 31 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 92 YCTASLLLCSCRIPAAPGDPLVLERPPP 9 Y LL SC +PGDPLVLERPPP Sbjct: 49 YTYIPLLSNSC----SPGDPLVLERPPP 72 >SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) Length = 362 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SLLLC PGDPLVLERPPP Sbjct: 60 SLLLC-------PGDPLVLERPPP 76 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 59 RIPAAPGDPLVLERPPP 9 ++ +PGDPLVLERPPP Sbjct: 38 KLYVSPGDPLVLERPPP 54 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 89 ANPGDPLVLERPPP 102 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 4/25 (16%) Frame = -2 Query: 71 LCSCRI----PAAPGDPLVLERPPP 9 +C C +PGDPLVLERPPP Sbjct: 18 ICDCHAHVSNSCSPGDPLVLERPPP 42 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 +L + + +PGDPLVLERPPP Sbjct: 56 NLFIITTSNSCSPGDPLVLERPPP 79 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 25 CFSSNSCSPGDPLVLERPPP 44 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 110 INKLTCYCTASLLLCSCRIPAAPGDPLVLERPPP 9 I+ + C L SC +PGDPLVLERPPP Sbjct: 35 IDVIRCLNKVQSLSNSC----SPGDPLVLERPPP 64 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_27752| Best HMM Match : ASC (HMM E-Value=3.7e-07) Length = 505 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 A PGDPLVLERPPP Sbjct: 25 AYPGDPLVLERPPP 38 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 33 SLISNSC----SPGDPLVLERPPP 52 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 83 ASLLLCSCRIPAAPGDPLVLERPPP 9 ++L + +PGDPLVLERPPP Sbjct: 81 SALFIIQTSNSCSPGDPLVLERPPP 105 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 104 KLTCYCTASLLLCSCRIPAAPGDPLVLERPPP 9 K+ TA ++ +PGDPLVLERPPP Sbjct: 38 KILASKTAGDVIAFISNSCSPGDPLVLERPPP 69 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -2 Query: 95 CYCTASLLLCSCRIPAAPGDPLVLERPPP 9 C A L++ + +PGDPLVLERPPP Sbjct: 4 CQFKADLVIKTSN-SCSPGDPLVLERPPP 31 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 68 CSCRIPAAPGDPLVLERPPP 9 C +PGDPLVLERPPP Sbjct: 25 CYVSNSCSPGDPLVLERPPP 44 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 32 SLISNSC----SPGDPLVLERPPP 51 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -2 Query: 86 TASLLLCSCRIPAAPGDPLVLERPPP 9 +A+++ SC +PGDPLVLERPPP Sbjct: 10 SANIISNSC----SPGDPLVLERPPP 31 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.7 bits (71), Expect = 0.48 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 80 SLLLCSCRIPAAPGDPLVLERPPP 9 SL+ SC +PGDPLVLERPPP Sbjct: 30 SLISNSC----SPGDPLVLERPPP 49 >SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) Length = 159 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 50 AAPGDPLVLERPPP 9 ++PGDPLVLERPPP Sbjct: 40 SSPGDPLVLERPPP 53 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 16 SPGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 14 SPGDPLVLERPPP 26 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 39 SPGDPLVLERPPP 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 30 SPGDPLVLERPPP 42 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 31 SPGDPLVLERPPP 43 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 12 SPGDPLVLERPPP 24 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 188 SPGDPLVLERPPP 200 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 83 SPGDPLVLERPPP 95 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 19 SPGDPLVLERPPP 31 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 353 SPGDPLVLERPPP 365 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 10 SPGDPLVLERPPP 22 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 17 SPGDPLVLERPPP 29 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 31 SPGDPLVLERPPP 43 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 106 SPGDPLVLERPPP 118 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 35 SPGDPLVLERPPP 47 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 86 SPGDPLVLERPPP 98 >SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 32.3 bits (70), Expect = 0.64 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 9/51 (17%) Frame = +2 Query: 539 PCTSPSKPC----SRCTRPVVPPVSCWTPATVSPTPC-----PSTRDTHSP 664 P T PC + CT+ +P +TP T TPC PST +H+P Sbjct: 844 PSTKRYTPCYERYTPCTKRYIPSAKRYTPCTERYTPCTKRYTPSTEPSHAP 894 Score = 29.9 bits (64), Expect = 3.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 515 CSKHSTRPPCTSPSKPCSR----CTRPVVPPVSCWTPATVSPTPC 637 C++ T PCT PC+ CT P +TP+T TPC Sbjct: 626 CTERYT--PCTERYIPCTERYTPCTERYTPSTERYTPSTERYTPC 668 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 539 PCTSPSKPC----SRCTRPVVPPVSCWTPATVSPTPC 637 PCT PC + CT+ P +TP T TPC Sbjct: 746 PCTERYTPCYERYTPCTKRYTPCTERYTPCTERYTPC 782 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 520 SPGDPLVLERPPP 532 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 386 SPGDPLVLERPPP 398 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 28 SPGDPLVLERPPP 40 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 26 SPGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 35 SPGDPLVLERPPP 47 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 12 SPGDPLVLERPPP 24 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 26 SPGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 23 SPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 56 SPGDPLVLERPPP 68 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 58 SPGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 266 SPGDPLVLERPPP 278 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 29 SPGDPLVLERPPP 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 23 SPGDPLVLERPPP 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 23 SPGDPLVLERPPP 35 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 17 SPGDPLVLERPPP 29 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 167 SPGDPLVLERPPP 179 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 24 SPGDPLVLERPPP 36 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 25 SPGDPLVLERPPP 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 39 SPGDPLVLERPPP 51 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 48 SPGDPLVLERPPP 60 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 68 SPGDPLVLERPPP 80 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 635 SPGDPLVLERPPP 647 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 20 SPGDPLVLERPPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 9 SPGDPLVLERPPP 21 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 52 SPGDPLVLERPPP 64 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 117 SPGDPLVLERPPP 129 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 47 SPGDPLVLERPPP 59 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 897 SPGDPLVLERPPP 909 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 29 SPGDPLVLERPPP 41 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 98 SPGDPLVLERPPP 110 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 69 SPGDPLVLERPPP 81 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 19 SPGDPLVLERPPP 31 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 880 SPGDPLVLERPPP 892 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 15 SPGDPLVLERPPP 27 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 53 SPGDPLVLERPPP 65 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 9 SPGDPLVLERPPP 21 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 22 SPGDPLVLERPPP 34 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 24 SPGDPLVLERPPP 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 68 SPGDPLVLERPPP 80 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 47 SPGDPLVLERPPP 59 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 30 SPGDPLVLERPPP 42 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 43 SPGDPLVLERPPP 55 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 25 SPGDPLVLERPPP 37 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 28 SPGDPLVLERPPP 40 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 45 SPGDPLVLERPPP 57 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 44 SPGDPLVLERPPP 56 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 29 SPGDPLVLERPPP 41 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 56 IPAAPGDPLVLERPPP 9 I PGDPLVLERPPP Sbjct: 750 IRECPGDPLVLERPPP 765 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 19 SPGDPLVLERPPP 31 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 146 SPGDPLVLERPPP 158 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 487 SPGDPLVLERPPP 499 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 39 SPGDPLVLERPPP 51 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 14 SPGDPLVLERPPP 26 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 85 SPGDPLVLERPPP 97 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 65 SPGDPLVLERPPP 77 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 28 SPGDPLVLERPPP 40 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 8 SPGDPLVLERPPP 20 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 58 SPGDPLVLERPPP 70 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 11 SPGDPLVLERPPP 23 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 27 SPGDPLVLERPPP 39 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 26 SPGDPLVLERPPP 38 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 38 SPGDPLVLERPPP 50 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 51 SPGDPLVLERPPP 63 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 18 SPGDPLVLERPPP 30 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 6 SPGDPLVLERPPP 18 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 7 SPGDPLVLERPPP 19 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 1026 SPGDPLVLERPPP 1038 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 21 SPGDPLVLERPPP 33 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 47 APGDPLVLERPPP 9 +PGDPLVLERPPP Sbjct: 125 SPGDPLVLERPPP 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,245,532 Number of Sequences: 59808 Number of extensions: 691468 Number of successful extensions: 4269 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4188 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 3003134652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -