BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1241 (1005 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 25 0.81 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 4.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 5.7 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 25.4 bits (53), Expect = 0.81 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 293 VPY-RPSRPDGGAFHDRGEHGARSIXSCETGLAHTGAIVYYQRGNF 159 VPY R RPD +++ + ++ + ++HTG +V+ G F Sbjct: 82 VPYNRVWRPDTILYNNADPQYSSAVINTNVIVSHTGEVVWLSHGIF 127 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 4.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 428 LRVAPEEHPVLLTEAPLNPKANREKM 505 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 5.7 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 570 AVRVRSYHRYRAGLRRRCLPHRAHLRGIRTPPRH-PASGXXPVATFT 707 ++ +++HR C P +L I + P H PAS AT T Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPASSTSLPATIT 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 265,871 Number of Sequences: 438 Number of extensions: 6352 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 33379164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -