BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1236 (671 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 27 0.16 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.1 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.1 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 27.1 bits (57), Expect = 0.16 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +2 Query: 239 TGVPYRFRYNKINNMGHGPHAGNVVAPSNFILCIASCSNVPVICCGNIILFL 394 + +P+ Y K+N + + P +GN A S + ++ P+ II FL Sbjct: 172 SAIPFAI-YTKVNLVEYPPESGNYSADSAMCAMLTIYADFPLYELSTIIFFL 222 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 165 SVSKLIEPELILENNGSLSVSTIIALGSHIVLG 263 ++SKL +PE+ ++ + S + LG+ + LG Sbjct: 270 NLSKLSDPEVWIDAVTQIFFSYALGLGALVALG 302 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 165 SVSKLIEPELILENNGSLSVSTIIALGSHIVLG 263 ++SKL +PE+ ++ + S + LG+ + LG Sbjct: 323 NLSKLSDPEVWIDAVTQIFFSYALGLGALVALG 355 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 237 ALGSHIVLGIIKLITWAMVHMLGMWWPPQTSFYASLHAAMFLSFA 371 A + LGI ++T + + P+ + +L +FLSFA Sbjct: 241 ATADRVSLGITTVLTMTFLGLEARTDLPKVPYPTALDFFVFLSFA 285 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 207 NGSLSVSTIIALGSHIVLGIIKLITWAMVHMLGMW 311 +G LS +I IVL I WA++ ++G+W Sbjct: 154 DGKLSRGQVILF---IVLIWTYTIPWALMPVMGVW 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,822 Number of Sequences: 438 Number of extensions: 5807 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -