BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1231 (806 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506... 29 5.8 >04_04_0964 - 29749624-29749649,29749742-29749945,29750036-29750634, 29750742-29750826,29750914-29751562,29751568-29751643, 29753891-29753957,29754097-29754998,29756579-29756790 Length = 939 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 286 LPTDHQLITLSKKLMLNSPFYCNFNTLKSCKHAHVFNTC 170 LPTD TL +K +LN +N+ + H F C Sbjct: 634 LPTDFARPTLKEKFLLNFKLELEYNSFFAFDHVSYFRMC 672 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,809,950 Number of Sequences: 37544 Number of extensions: 332279 Number of successful extensions: 559 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -