BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1231 (806 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 26 1.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 3.6 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 25.8 bits (54), Expect = 1.6 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 10 LGFQNKTSRE--LRILHEKHNNVTERSELYYVSDTND*TLDSTAVFIGLRTRQRVYKY 177 L + + SR I H H V + ++ +N TL + AVF+ R +++Y Sbjct: 70 LAYADAVSRRGGFSIFHPSHQRVASQLIELFLEQSNPDTLTAMAVFVRDRVNGPLFQY 127 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 753 HTHYYVLNT*FYLSHFPDHE 694 H HYY T F+L DH+ Sbjct: 977 HCHYYETQTSFWLVSLEDHQ 996 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,181 Number of Sequences: 2352 Number of extensions: 16040 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -