BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1231 (806 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53330.1 68414.m06045 pentatricopeptide (PPR) repeat-containi... 29 3.6 At1g60180.1 68414.m06779 hypothetical protein similar to hypothe... 28 8.4 >At1g53330.1 68414.m06045 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 471 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -2 Query: 424 FKPFKPSLDFHKSFKTKICQIGPAQVLARLTNS 326 FK +KP D + F K+C+ G ++L+++ +S Sbjct: 391 FKGYKPRRDRLEGFLQKLCESGKLEILSKVISS 423 >At1g60180.1 68414.m06779 hypothetical protein similar to hypothetical protein GI:6017113 from [Arabidopsis thaliana] Length = 296 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +2 Query: 458 CFTFDVSTVGRIPFVCFSLFYTKVLVFYLSIEALRSLPGQLVNNKIKWRCNIL 616 C DVS++ CF + K L YL + L+ L K+ + CNIL Sbjct: 93 CALVDVSSLDEAQVDCFIYSHLKTLDAYLLQDILKMLEKLQNAEKLIFGCNIL 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,393,931 Number of Sequences: 28952 Number of extensions: 301427 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -