BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1226 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.1 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 4.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.7 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 7.6 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -2 Query: 379 STILLPSVRVFDLSRCSVYSIS 314 ST+ +PSV++ + +CS+ SI+ Sbjct: 388 STLNIPSVKIDEDQKCSIESIT 409 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 127 NQPKEWHKDANKSPDHDQGPSSPAKEGEAFT 219 N +H+ +K+ D+D S A GE+FT Sbjct: 219 NSDDSFHRLTSKTFDNDLRYSELAVAGESFT 249 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/44 (27%), Positives = 17/44 (38%) Frame = +1 Query: 112 GNAGSNQPKEWHKDANKSPDHDQGPSSPAKEGEAFTFDKKLDDD 243 G G N + D N D+D G + TF + D+D Sbjct: 99 GRTGFNNKNKDGDDNNDYEDNDYGNQDNRNDRRKKTFAAREDND 142 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 536 KYFVDGEWRHDPTVKVIDNGMG 601 K+FV G W+ + T I++ +G Sbjct: 4 KFFVGGNWKMNGTKSEINDIVG 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,413 Number of Sequences: 438 Number of extensions: 3946 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -