BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1224 (800 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IAT7 Cluster: Abc transporter, putative; n=7; Plasmod... 35 2.7 >UniRef50_Q8IAT7 Cluster: Abc transporter, putative; n=7; Plasmodium|Rep: Abc transporter, putative - Plasmodium falciparum (isolate 3D7) Length = 940 Score = 34.7 bits (76), Expect = 2.7 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 5/123 (4%) Frame = +2 Query: 386 FEIFTF*PFRI-----VHSSIYRIKKKCYVSMCSFNIYL*VSFDIKFTILYENVFTR*LQ 550 F+ F + PF VH +I KKK V + +Y + DIK +L+ N +T L Sbjct: 612 FDYFNYEPFASASIGQVHDAIINKKKKVAVKIQYPGVYESIDSDIK-NLLFINQYTN-LI 669 Query: 551 IEFLHIADFALTATK*YLKT*VDEGDMIQFVNFEKTGKKNSCYLYFIFVYNSFITCNFLK 730 ++ L+I + K LK D + ++ K KNS Y Y +Y +IT + L Sbjct: 670 LKNLYIENLCNVIQK-ELKCECDYINEAKYYALFKNIFKNSKYFYVPSIYPEYITKHVLV 728 Query: 731 IAF 739 ++ Sbjct: 729 TSY 731 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,719,436 Number of Sequences: 1657284 Number of extensions: 13379562 Number of successful extensions: 25731 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25729 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68731504465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -