BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1224 (800 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-47... 29 5.7 01_06_1560 + 38251268-38251471,38251567-38251672,38251992-382522... 28 9.9 >03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-477210, 477303-477497,477627-477701,478082-478179,478328-478421 Length = 303 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 451 LFFYTVDRAVNYTKRSKSKNLKSAHSKQILV*QRRFEENVW 329 LFF +V + KR K ++ H + +++ R F VW Sbjct: 259 LFFELFTASVCFGKRIKHSSISEGHDENLVIDNREFPFKVW 299 >01_06_1560 + 38251268-38251471,38251567-38251672,38251992-38252203, 38252306-38252512,38253327-38254694 Length = 698 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 653 KTGKKNSCYLYFIFVYNSFITCNFLKIAFK 742 K GK+N C L F+F+ +F C FLK+ K Sbjct: 140 KKGKENICRLDFVFLDCTFSKC-FLKLPSK 168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,752,681 Number of Sequences: 37544 Number of extensions: 341192 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -