BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1223 (712 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 24 1.1 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 7.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.5 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +3 Query: 513 YAKYHQRKPGAGQYIMNNVRTDI 581 YA + ++PG GQ++ ++ D+ Sbjct: 29 YASWGAQRPGNGQFVPEDINPDL 51 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 67 LPTFFLKREDAG*RPSSYSKATSTARAPATACLPL 171 LP F + + RPS Y + + A +P +P+ Sbjct: 473 LPVFLQEHRNGMYRPSIYFISKTLAESPIFIIIPV 507 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 67 LPTFFLKREDAG*RPSSYSKATSTARAPATACLPL 171 LP F + + RPS Y + + A +P +P+ Sbjct: 473 LPVFLQEHRNGMYRPSIYFISKTLAESPIFIIIPV 507 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,234 Number of Sequences: 336 Number of extensions: 1930 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -