BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1222X (475 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1373 + 33025059-33025422,33025510-33025551,33025836-330260... 28 3.3 01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 27 7.7 >04_04_1373 + 33025059-33025422,33025510-33025551,33025836-33026054, 33026145-33026384,33026483-33027508,33027770-33028545 Length = 888 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 7 SSERYPINTKLSNFSCAKWCLPTFFLKRED 96 S E Y N KL N S WC P + +ED Sbjct: 817 SMESYVGNNKLYNTSQGSWCSPNGHVPKED 846 >01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 Length = 417 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 3/21 (14%) Frame = -3 Query: 395 APDYSWPSHKLN---PFAIRL 342 AP ++WPSHKL+ PF +R+ Sbjct: 151 APRHNWPSHKLSYSQPFELRV 171 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,446,988 Number of Sequences: 37544 Number of extensions: 141168 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -