BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1222X (475 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 2.6 SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_9782| Best HMM Match : FeoB_C (HMM E-Value=0.95) 27 6.0 SB_48168| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 90 RRRWLKAFKLFKGNKHRKSSRNRVSPSLVRSPSYNGTVDARSEIDVHKF 236 R +++ ++++GNKH+ + VRS YNG + A D +F Sbjct: 158 RIAFMRMGRVYRGNKHQLFFLTFIDTVKVRSAGYNGAIAALIYQDPEQF 206 >SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 28.3 bits (60), Expect = 3.4 Identities = 8/29 (27%), Positives = 22/29 (75%) Frame = +3 Query: 126 GNKHRKSSRNRVSPSLVRSPSYNGTVDAR 212 GN H+ +S+ +V +++++ + +GT+D++ Sbjct: 735 GNDHKTASKTKVQSTVIQTCNLDGTIDSK 763 >SB_9782| Best HMM Match : FeoB_C (HMM E-Value=0.95) Length = 164 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 117 LFKGNKHRKSSRNRVSPSLVRSPSYNGTVDARSEIDVHKFCGCRTSY 257 L +G++ R R R+ PS S+N T + SE+ H C R S+ Sbjct: 108 LLRGDRGRVI-RMRIRPSSHGGVSHNATGEINSEVRHHVSCPSRNSH 153 >SB_48168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 98 LVEGLQAIQRQQAPQELPQPRVSLSGSL 181 L+ GL + Q + LP P+ SL GSL Sbjct: 282 LIWGLSVFESQSSKNHLPHPKGSLFGSL 309 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,826,527 Number of Sequences: 59808 Number of extensions: 157011 Number of successful extensions: 552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -